Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CP942_RS16660 Genome accession   NZ_CP023666
Coordinates   3375255..3375395 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain Bac48     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3370255..3380395
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CP942_RS16630 - 3370358..3370759 (+) 402 WP_025809741.1 YueI family protein -
  CP942_RS16635 - 3370943..3371494 (+) 552 WP_026580053.1 cysteine hydrolase family protein -
  CP942_RS16640 - 3371512..3372981 (+) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  CP942_RS16645 - 3373159..3374379 (+) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  CP942_RS16650 - 3374422..3374769 (-) 348 WP_224146417.1 SDR family oxidoreductase -
  CP942_RS16660 degQ 3375255..3375395 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  CP942_RS16665 - 3375583..3376485 (+) 903 WP_105979882.1 polyprenyl synthetase family protein -
  CP942_RS16670 comX 3376469..3376642 (+) 174 WP_043927976.1 competence pheromone ComX -
  CP942_RS16675 comP 3376658..3378970 (+) 2313 WP_105979884.1 ATP-binding protein Regulator
  CP942_RS16680 comA 3379057..3379695 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  CP942_RS16685 - 3379712..3380101 (+) 390 WP_009329508.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=249123 CP942_RS16660 WP_003184860.1 3375255..3375395(+) (degQ) [Bacillus paralicheniformis strain Bac48]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=249123 CP942_RS16660 WP_003184860.1 3375255..3375395(+) (degQ) [Bacillus paralicheniformis strain Bac48]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment