Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   CPU08_RS04025 Genome accession   NZ_CP023655
Coordinates   791380..791862 (+) Length   160 a.a.
NCBI ID   WP_141822585.1    Uniprot ID   -
Organism   Pediococcus pentosaceus strain JQI-7     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 780988..824959 791380..791862 within 0


Gene organization within MGE regions


Location: 780988..824959
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CPU08_RS03940 (CPU08_03930) fabI 780988..781746 (+) 759 WP_060743755.1 enoyl-ACP reductase FabI -
  CPU08_RS03945 (CPU08_03935) - 781885..783057 (-) 1173 WP_141822563.1 site-specific integrase -
  CPU08_RS03950 (CPU08_03940) - 783154..783456 (-) 303 WP_029257881.1 hypothetical protein -
  CPU08_RS03955 (CPU08_03945) - 783545..784615 (-) 1071 WP_141822565.1 DUF4236 domain-containing protein -
  CPU08_RS03960 (CPU08_03950) - 784727..785164 (-) 438 WP_141822567.1 hypothetical protein -
  CPU08_RS03965 (CPU08_03955) - 785220..785618 (-) 399 WP_069825264.1 hypothetical protein -
  CPU08_RS03970 (CPU08_03960) - 785622..785996 (-) 375 WP_081332163.1 helix-turn-helix domain-containing protein -
  CPU08_RS03975 (CPU08_03965) - 786161..786394 (+) 234 WP_069825265.1 XRE family transcriptional regulator -
  CPU08_RS03980 (CPU08_03970) - 786391..786633 (+) 243 WP_141822569.1 hypothetical protein -
  CPU08_RS03985 (CPU08_03975) - 786707..787165 (+) 459 WP_260603364.1 helix-turn-helix domain-containing protein -
  CPU08_RS03990 (CPU08_03980) - 787166..787441 (+) 276 WP_141822571.1 hypothetical protein -
  CPU08_RS03995 (CPU08_03985) - 787675..787956 (+) 282 WP_141822573.1 hypothetical protein -
  CPU08_RS04000 (CPU08_03990) - 787949..788800 (+) 852 WP_141822575.1 recombinase RecT -
  CPU08_RS04005 (CPU08_03995) - 788760..789587 (+) 828 WP_141822577.1 PD-(D/E)XK nuclease-like domain-containing protein -
  CPU08_RS04010 (CPU08_04000) - 789597..790427 (+) 831 WP_141822579.1 helix-turn-helix domain-containing protein -
  CPU08_RS04015 (CPU08_04005) - 790430..791131 (+) 702 WP_141822581.1 putative HNHc nuclease -
  CPU08_RS04020 (CPU08_04010) - 791100..791360 (+) 261 WP_141822583.1 hypothetical protein -
  CPU08_RS04025 (CPU08_04015) ssb 791380..791862 (+) 483 WP_141822585.1 single-stranded DNA-binding protein Machinery gene
  CPU08_RS08785 (CPU08_04020) - 791873..792190 (+) 318 WP_185831478.1 DeoR family transcriptional regulator -
  CPU08_RS08790 - 792193..792366 (+) 174 WP_185831479.1 hypothetical protein -
  CPU08_RS04035 (CPU08_04025) - 792356..792715 (+) 360 WP_141822589.1 hypothetical protein -
  CPU08_RS04040 (CPU08_04030) - 792721..793107 (+) 387 WP_141822591.1 hypothetical protein -
  CPU08_RS04045 (CPU08_04035) - 793195..793611 (+) 417 WP_185831480.1 ArpU family phage packaging/lysis transcriptional regulator -
  CPU08_RS04055 (CPU08_04045) - 793959..794483 (+) 525 WP_141822593.1 hypothetical protein -
  CPU08_RS04060 - 794721..794918 (+) 198 WP_141822595.1 hypothetical protein -
  CPU08_RS04065 (CPU08_04050) - 794981..795796 (+) 816 WP_141822597.1 hypothetical protein -
  CPU08_RS04070 (CPU08_04055) - 795866..796471 (+) 606 WP_141822599.1 terminase small subunit -
  CPU08_RS04075 (CPU08_04060) - 796455..797726 (+) 1272 WP_141822601.1 PBSX family phage terminase large subunit -
  CPU08_RS04080 (CPU08_04065) - 797734..799131 (+) 1398 WP_141822603.1 phage portal protein -
  CPU08_RS04085 (CPU08_04070) - 799115..800077 (+) 963 WP_141822605.1 minor capsid protein -
  CPU08_RS04090 (CPU08_04075) - 800080..800478 (+) 399 WP_141822607.1 hypothetical protein -
  CPU08_RS08795 - 800704..800865 (+) 162 WP_185831481.1 hypothetical protein -
  CPU08_RS04095 (CPU08_04080) - 800983..801594 (+) 612 WP_185831482.1 DUF4355 domain-containing protein -
  CPU08_RS04100 (CPU08_04085) - 801609..802523 (+) 915 WP_011673260.1 hypothetical protein -
  CPU08_RS04105 (CPU08_04090) - 802562..802807 (+) 246 WP_260603365.1 Ig-like domain-containing protein -
  CPU08_RS04110 (CPU08_04095) - 802819..803190 (+) 372 WP_141822613.1 phage head-tail connector protein -
  CPU08_RS04115 (CPU08_04100) - 803195..803497 (+) 303 WP_141822615.1 hypothetical protein -
  CPU08_RS04120 (CPU08_04105) - 803490..803861 (+) 372 WP_141822617.1 HK97-gp10 family putative phage morphogenesis protein -
  CPU08_RS04125 (CPU08_04110) - 803862..804269 (+) 408 WP_141822619.1 hypothetical protein -
  CPU08_RS04130 (CPU08_04115) - 804287..804883 (+) 597 WP_141822621.1 phage major tail protein, TP901-1 family -
  CPU08_RS04135 (CPU08_04120) - 804961..805239 (+) 279 WP_141822623.1 hypothetical protein -
  CPU08_RS04140 (CPU08_04125) - 805319..805657 (+) 339 WP_141822625.1 tail assembly chaperone -
  CPU08_RS04145 (CPU08_04130) - 805759..806091 (+) 333 WP_229572677.1 hypothetical protein -
  CPU08_RS04150 (CPU08_04135) - 806084..809434 (+) 3351 WP_141822629.1 phage tail tape measure protein -
  CPU08_RS04155 (CPU08_04140) - 809434..810198 (+) 765 WP_141822631.1 phage tail protein -
  CPU08_RS04160 (CPU08_04145) - 810198..813182 (+) 2985 WP_141822633.1 peptidoglycan amidohydrolase family protein -
  CPU08_RS04165 (CPU08_04150) - 813166..813612 (+) 447 WP_141822635.1 hypothetical protein -
  CPU08_RS04170 (CPU08_04155) - 813616..815472 (+) 1857 WP_141822637.1 BppU family phage baseplate upper protein -
  CPU08_RS04175 (CPU08_04160) - 815481..816233 (+) 753 WP_141822639.1 hypothetical protein -
  CPU08_RS04180 (CPU08_04165) - 816233..816583 (+) 351 WP_141822641.1 DUF2977 domain-containing protein -
  CPU08_RS04185 (CPU08_04170) - 816583..816714 (+) 132 WP_141822643.1 XkdX family protein -
  CPU08_RS04190 (CPU08_04175) - 816764..817048 (+) 285 WP_141822924.1 hypothetical protein -
  CPU08_RS04195 (CPU08_04180) - 817048..817287 (+) 240 WP_141822645.1 phage holin -
  CPU08_RS04200 (CPU08_04185) - 817271..818392 (+) 1122 WP_141822647.1 peptidoglycan recognition family protein -
  CPU08_RS04205 (CPU08_04190) - 819580..820956 (+) 1377 WP_128886915.1 amino acid permease -
  CPU08_RS04210 (CPU08_04195) - 821116..822282 (+) 1167 WP_128886914.1 hydroxymethylglutaryl-CoA synthase -
  CPU08_RS04215 (CPU08_04200) - 822322..822921 (-) 600 WP_060743702.1 hypothetical protein -
  CPU08_RS04220 (CPU08_04205) lexA 823000..823629 (-) 630 WP_002833597.1 transcriptional repressor LexA -
  CPU08_RS04225 (CPU08_04210) - 823763..824011 (+) 249 WP_002833598.1 DUF896 domain-containing protein -
  CPU08_RS04230 (CPU08_04215) - 824082..824303 (+) 222 WP_002833599.1 YneF family protein -
  CPU08_RS04235 (CPU08_04220) - 824315..824959 (-) 645 WP_029257926.1 1-acyl-sn-glycerol-3-phosphate acyltransferase -

Sequence


Protein


Download         Length: 160 a.a.        Molecular weight: 18143.88 Da        Isoelectric Point: 6.3630

>NTDB_id=248923 CPU08_RS04025 WP_141822585.1 791380..791862(+) (ssb) [Pediococcus pentosaceus strain JQI-7]
MINRTVLVGRLTRDPELKYTNSGRAVASFNIAVNRKFTNSQGEREADFINCVIWNKTAENFCNFIRKGSLVGIDGRIQTR
SYENQQGTRIYVTEVVAENFSLLESKNSSQNEQFEQNRPQSNGQNYQNKQNGQSSPSRNPNDPFTNGVQGIDINDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=248923 CPU08_RS04025 WP_141822585.1 791380..791862(+) (ssb) [Pediococcus pentosaceus strain JQI-7]
ATGATTAATCGAACTGTTTTAGTTGGCCGGTTGACGCGTGATCCAGAATTGAAATACACCAACAGTGGAAGGGCGGTAGC
TAGCTTTAACATAGCCGTTAACCGTAAATTTACAAATTCACAGGGCGAGCGCGAAGCGGACTTTATTAACTGCGTTATTT
GGAATAAAACGGCGGAAAACTTCTGTAACTTCATTCGCAAAGGGTCACTGGTTGGAATTGATGGACGAATTCAAACTCGA
TCATACGAAAATCAACAAGGAACACGAATTTACGTTACTGAAGTTGTAGCCGAAAATTTTTCGCTGCTTGAGTCCAAAAA
CAGTAGTCAAAATGAACAATTTGAACAGAATAGACCTCAAAGCAATGGACAAAATTATCAGAATAAACAAAATGGTCAAT
CATCACCTAGTAGAAATCCTAACGACCCATTCACTAATGGCGTCCAAGGAATTGATATTAACGACGACGATTTACCGTTT
TAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.77

100

0.65

  ssbA Bacillus subtilis subsp. subtilis str. 168

54.07

100

0.581

  ssbB Bacillus subtilis subsp. subtilis str. 168

56.604

66.25

0.375


Multiple sequence alignment