Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | CHN56_RS15590 | Genome accession | NZ_CP022654 |
| Coordinates | 3110865..3111005 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain SCDB 291 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3105865..3116005
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CHN56_RS15560 (CHN56_03079) | - | 3106169..3106567 (+) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
| CHN56_RS15565 (CHN56_03080) | - | 3106664..3107215 (+) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| CHN56_RS15570 (CHN56_03081) | - | 3107233..3108699 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| CHN56_RS15575 (CHN56_03082) | - | 3108829..3110052 (+) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| CHN56_RS15580 (CHN56_03083) | - | 3110059..3110400 (-) | 342 | WP_014418765.1 | hypothetical protein | - |
| CHN56_RS15590 (CHN56_03084) | degQ | 3110865..3111005 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| CHN56_RS15595 (CHN56_03085) | - | 3111157..3112068 (+) | 912 | WP_031378407.1 | polyprenyl synthetase family protein | - |
| CHN56_RS15600 (CHN56_03086) | comX | 3112068..3112232 (+) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| CHN56_RS15605 (CHN56_03087) | comP | 3112244..3114535 (+) | 2292 | WP_094247540.1 | histidine kinase | Regulator |
| CHN56_RS15610 (CHN56_03088) | comA | 3114616..3115260 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| CHN56_RS15615 (CHN56_03089) | - | 3115282..3115665 (+) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=241328 CHN56_RS15590 WP_003152043.1 3110865..3111005(+) (degQ) [Bacillus velezensis strain SCDB 291]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=241328 CHN56_RS15590 WP_003152043.1 3110865..3111005(+) (degQ) [Bacillus velezensis strain SCDB 291]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |