Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CF389_RS19060 Genome accession   NZ_CP022556
Coordinates   3830568..3830708 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain NJAU-Z9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3825568..3835708
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CF389_RS19035 - 3825874..3826272 (+) 399 WP_003152031.1 YueI family protein -
  CF389_RS19040 - 3826369..3826920 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  CF389_RS19045 - 3826938..3828404 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  CF389_RS19050 - 3828534..3829754 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  CF389_RS19055 - 3829761..3830102 (-) 342 WP_003152040.1 hypothetical protein -
  CF389_RS19060 degQ 3830568..3830708 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CF389_RS19065 comQ 3830893..3831825 (+) 933 WP_050560672.1 class 1 isoprenoid biosynthesis enzyme Regulator
  CF389_RS19075 comP 3831978..3834281 (+) 2304 WP_003152050.1 histidine kinase Regulator
  CF389_RS19080 comA 3834362..3835006 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  CF389_RS19085 - 3835028..3835411 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=240759 CF389_RS19060 WP_003152043.1 3830568..3830708(+) (degQ) [Bacillus velezensis strain NJAU-Z9]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=240759 CF389_RS19060 WP_003152043.1 3830568..3830708(+) (degQ) [Bacillus velezensis strain NJAU-Z9]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment