Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CF389_RS02860 Genome accession   NZ_CP022556
Coordinates   529460..529837 (+) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain NJAU-Z9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 524460..534837
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CF389_RS02825 - 524776..525726 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  CF389_RS02830 comGA 525918..526988 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CF389_RS02835 comGB 526975..528012 (+) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  CF389_RS02840 comGC 528059..528325 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  CF389_RS02845 comGD 528315..528752 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  CF389_RS02850 comGE 528736..529050 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  CF389_RS02855 comGF 529064..529459 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  CF389_RS02860 comGG 529460..529837 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  CF389_RS02865 - 529894..530073 (+) 180 WP_003153093.1 YqzE family protein -
  CF389_RS02870 - 530113..530442 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  CF389_RS02875 tapA 530701..531372 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  CF389_RS02880 sipW 531344..531928 (+) 585 WP_003153100.1 signal peptidase I SipW -
  CF389_RS02885 tasA 531992..532777 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  CF389_RS02890 sinR 532825..533160 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CF389_RS02895 sinI 533194..533367 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  CF389_RS02900 - 533544..534338 (-) 795 WP_003153106.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=240704 CF389_RS02860 WP_003153092.1 529460..529837(+) (comGG) [Bacillus velezensis strain NJAU-Z9]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=240704 CF389_RS02860 WP_003153092.1 529460..529837(+) (comGG) [Bacillus velezensis strain NJAU-Z9]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment