Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CF389_RS02895 Genome accession   NZ_CP022556
Coordinates   533194..533367 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain NJAU-Z9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 528194..538367
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CF389_RS02845 comGD 528315..528752 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  CF389_RS02850 comGE 528736..529050 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  CF389_RS02855 comGF 529064..529459 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  CF389_RS02860 comGG 529460..529837 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  CF389_RS02865 - 529894..530073 (+) 180 WP_003153093.1 YqzE family protein -
  CF389_RS02870 - 530113..530442 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  CF389_RS02875 tapA 530701..531372 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  CF389_RS02880 sipW 531344..531928 (+) 585 WP_003153100.1 signal peptidase I SipW -
  CF389_RS02885 tasA 531992..532777 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  CF389_RS02890 sinR 532825..533160 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CF389_RS02895 sinI 533194..533367 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  CF389_RS02900 - 533544..534338 (-) 795 WP_003153106.1 YqhG family protein -
  CF389_RS02905 - 534356..536026 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  CF389_RS02910 gcvT 536449..537549 (+) 1101 WP_003153108.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=240706 CF389_RS02895 WP_003153105.1 533194..533367(-) (sinI) [Bacillus velezensis strain NJAU-Z9]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=240706 CF389_RS02895 WP_003153105.1 533194..533367(-) (sinI) [Bacillus velezensis strain NJAU-Z9]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment