Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   CG798_RS17700 Genome accession   NZ_CP022531
Coordinates   3554054..3554320 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain TB1501     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3549054..3559320
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CG798_RS17650 (CG798_17650) sinR 3549218..3549553 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CG798_RS17655 (CG798_17655) - 3549601..3550386 (-) 786 WP_007408329.1 TasA family protein -
  CG798_RS17660 (CG798_17660) - 3550451..3551035 (-) 585 WP_015240205.1 signal peptidase I -
  CG798_RS17665 (CG798_17665) tapA 3551007..3551678 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  CG798_RS17670 (CG798_17670) - 3551937..3552266 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CG798_RS17675 (CG798_17675) - 3552306..3552485 (-) 180 WP_003153093.1 YqzE family protein -
  CG798_RS17680 (CG798_17680) comGG 3552542..3552919 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  CG798_RS17685 (CG798_17685) comGF 3552920..3553420 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  CG798_RS17690 (CG798_17690) comGE 3553329..3553643 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  CG798_RS17695 (CG798_17695) comGD 3553627..3554064 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  CG798_RS17700 (CG798_17700) comGC 3554054..3554320 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  CG798_RS17705 (CG798_17705) comGB 3554367..3555404 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  CG798_RS17710 (CG798_17710) comGA 3555391..3556461 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CG798_RS17715 (CG798_17715) - 3556655..3557605 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  CG798_RS17720 (CG798_17720) - 3557751..3559052 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=240436 CG798_RS17700 WP_042635730.1 3554054..3554320(-) (comGC) [Bacillus velezensis strain TB1501]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=240436 CG798_RS17700 WP_042635730.1 3554054..3554320(-) (comGC) [Bacillus velezensis strain TB1501]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment