Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CG798_RS17645 | Genome accession | NZ_CP022531 |
| Coordinates | 3549011..3549184 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain TB1501 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3544011..3554184
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CG798_RS17630 (CG798_17630) | gcvT | 3544823..3545924 (-) | 1102 | Protein_3378 | glycine cleavage system aminomethyltransferase GcvT | - |
| CG798_RS17635 (CG798_17635) | - | 3546348..3548018 (+) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| CG798_RS17640 (CG798_17640) | - | 3548040..3548834 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| CG798_RS17645 (CG798_17645) | sinI | 3549011..3549184 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| CG798_RS17650 (CG798_17650) | sinR | 3549218..3549553 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CG798_RS17655 (CG798_17655) | - | 3549601..3550386 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| CG798_RS17660 (CG798_17660) | - | 3550451..3551035 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| CG798_RS17665 (CG798_17665) | tapA | 3551007..3551678 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CG798_RS17670 (CG798_17670) | - | 3551937..3552266 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CG798_RS17675 (CG798_17675) | - | 3552306..3552485 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CG798_RS17680 (CG798_17680) | comGG | 3552542..3552919 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CG798_RS17685 (CG798_17685) | comGF | 3552920..3553420 (-) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| CG798_RS17690 (CG798_17690) | comGE | 3553329..3553643 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| CG798_RS17695 (CG798_17695) | comGD | 3553627..3554064 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=240432 CG798_RS17645 WP_003153105.1 3549011..3549184(+) (sinI) [Bacillus velezensis strain TB1501]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=240432 CG798_RS17645 WP_003153105.1 3549011..3549184(+) (sinI) [Bacillus velezensis strain TB1501]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |