Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C7M23_RS08425 Genome accession   NZ_CP028209
Coordinates   1637220..1637360 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM102745     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1632220..1642360
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M23_RS08395 (C7M23_01650) yueI 1632515..1632913 (+) 399 WP_015251331.1 YueI family protein -
  C7M23_RS08400 (C7M23_01651) pncA 1633010..1633561 (+) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  C7M23_RS08405 (C7M23_01652) pncB 1633577..1635049 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C7M23_RS08410 (C7M23_01653) pdeH 1635186..1636415 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C7M23_RS08415 (C7M23_01654) - 1636391..1636759 (-) 369 WP_014477834.1 hypothetical protein -
  C7M23_RS08420 - 1636873..1636998 (-) 126 WP_003228793.1 hypothetical protein -
  C7M23_RS08425 (C7M23_01655) degQ 1637220..1637360 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C7M23_RS08430 (C7M23_01656) comQ 1637545..1638405 (+) 861 WP_041850585.1 polyprenyl synthetase family protein Regulator
  C7M23_RS08435 (C7M23_01657) comX 1638418..1638582 (+) 165 WP_015384519.1 competence pheromone ComX -
  C7M23_RS08440 (C7M23_01658) comP 1638594..1640894 (+) 2301 WP_088300729.1 histidine kinase Regulator
  C7M23_RS08445 (C7M23_01659) comA 1640975..1641619 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C7M23_RS08450 (C7M23_01660) yuxO 1641638..1642018 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=239732 C7M23_RS08425 WP_003220708.1 1637220..1637360(+) (degQ) [Bacillus subtilis strain SRCM102745]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=239732 C7M23_RS08425 WP_003220708.1 1637220..1637360(+) (degQ) [Bacillus subtilis strain SRCM102745]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment