Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C7M17_RS02450 Genome accession   NZ_CP028202
Coordinates   427658..428041 (+) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102754     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 422658..433041
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M17_RS02415 (C7M17_00466) corA 423111..424064 (+) 954 WP_015483432.1 magnesium transporter CorA -
  C7M17_RS02420 (C7M17_00467) - 424066..424266 (+) 201 WP_122894890.1 hypothetical protein -
  C7M17_RS02425 (C7M17_00469) comGA 424476..425546 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  C7M17_RS02430 (C7M17_00470) comGB 425533..426570 (+) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  C7M17_RS02435 (C7M17_00471) comGC 426584..426880 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  C7M17_RS02440 (C7M17_00472) comGD 426870..427301 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  C7M17_RS02445 (C7M17_00473) comGE 427285..427632 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  C7M17_RS02450 comGF 427658..428041 (+) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  C7M17_RS02455 (C7M17_00475) comGG 428042..428416 (+) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  C7M17_RS02460 (C7M17_00476) spoIITA 428487..428666 (+) 180 WP_003230176.1 YqzE family protein -
  C7M17_RS02465 (C7M17_00477) yqzG 428708..429034 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M17_RS02470 (C7M17_00478) tapA 429306..430067 (+) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  C7M17_RS02475 (C7M17_00479) sipW 430051..430623 (+) 573 WP_003230181.1 signal peptidase I SipW -
  C7M17_RS02480 (C7M17_00480) tasA 430687..431472 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M17_RS02485 (C7M17_00481) sinR 431565..431900 (-) 336 WP_160245081.1 transcriptional regulator SinR Regulator
  C7M17_RS02490 (C7M17_00482) sinI 431934..432107 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=239554 C7M17_RS02450 WP_029317913.1 427658..428041(+) (comGF) [Bacillus subtilis strain SRCM102754]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=239554 C7M17_RS02450 WP_029317913.1 427658..428041(+) (comGF) [Bacillus subtilis strain SRCM102754]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment