Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | CGZ63_RS13320 | Genome accession | NZ_CP022445 |
| Coordinates | 2518392..2518670 (+) | Length | 92 a.a. |
| NCBI ID | WP_089607488.1 | Uniprot ID | - |
| Organism | Bacillus cereus C1L | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2509426..2553342 | 2518392..2518670 | within | 0 |
Gene organization within MGE regions
Location: 2509426..2553342
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGZ63_RS13260 | - | 2509426..2509689 (+) | 264 | WP_089607483.1 | DUF3937 family protein | - |
| CGZ63_RS13265 | - | 2510245..2510565 (+) | 321 | WP_001071364.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| CGZ63_RS32415 | - | 2510745..2510845 (+) | 101 | Protein_2482 | site-specific integrase | - |
| CGZ63_RS13270 | - | 2511055..2511540 (+) | 486 | WP_025687515.1 | hypothetical protein | - |
| CGZ63_RS13275 | - | 2511852..2512553 (+) | 702 | WP_063536437.1 | DUF3962 domain-containing protein | - |
| CGZ63_RS13280 | - | 2512592..2513701 (-) | 1110 | WP_089607484.1 | tyrosine-type recombinase/integrase | - |
| CGZ63_RS13285 | - | 2514307..2515515 (+) | 1209 | WP_089607485.1 | AimR family lysis-lysogeny pheromone receptor | - |
| CGZ63_RS32420 | - | 2515542..2515697 (+) | 156 | WP_162900577.1 | hypothetical protein | - |
| CGZ63_RS13290 | - | 2515961..2516311 (-) | 351 | WP_000367267.1 | helix-turn-helix transcriptional regulator | - |
| CGZ63_RS13295 | - | 2516498..2516722 (+) | 225 | WP_001192731.1 | helix-turn-helix transcriptional regulator | - |
| CGZ63_RS13300 | - | 2516763..2517029 (+) | 267 | WP_000522182.1 | helix-turn-helix domain-containing protein | - |
| CGZ63_RS32425 | - | 2517029..2517184 (+) | 156 | WP_080470707.1 | hypothetical protein | - |
| CGZ63_RS13315 | - | 2517405..2518388 (+) | 984 | WP_089607487.1 | DnaD domain protein | - |
| CGZ63_RS13320 | abrB | 2518392..2518670 (+) | 279 | WP_089607488.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| CGZ63_RS13325 | - | 2518663..2519022 (+) | 360 | WP_089607489.1 | cell division protein SepF | - |
| CGZ63_RS13330 | - | 2519042..2519209 (+) | 168 | WP_080470708.1 | DUF3954 domain-containing protein | - |
| CGZ63_RS13335 | - | 2519235..2519486 (+) | 252 | WP_089607490.1 | helix-turn-helix domain containing protein | - |
| CGZ63_RS13340 | - | 2519506..2519961 (+) | 456 | WP_089607491.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| CGZ63_RS13350 | - | 2522265..2523581 (+) | 1317 | WP_089607492.1 | exosporium glycoprotein BclB-related protein | - |
| CGZ63_RS13360 | - | 2523902..2524156 (+) | 255 | WP_089607493.1 | hypothetical protein | - |
| CGZ63_RS13365 | - | 2524338..2524802 (-) | 465 | WP_001010967.1 | hypothetical protein | - |
| CGZ63_RS13370 | - | 2524996..2525727 (-) | 732 | WP_232732738.1 | glycosyltransferase family 2 protein | - |
| CGZ63_RS13375 | - | 2525970..2526434 (-) | 465 | WP_089607495.1 | exosporium protein D | - |
| CGZ63_RS13385 | - | 2527338..2527541 (+) | 204 | WP_089607496.1 | hypothetical protein | - |
| CGZ63_RS13390 | - | 2528059..2528253 (+) | 195 | WP_089607497.1 | hypothetical protein | - |
| CGZ63_RS13395 | - | 2529115..2529771 (+) | 657 | WP_089607498.1 | hypothetical protein | - |
| CGZ63_RS32430 | - | 2529931..2530101 (+) | 171 | WP_089607499.1 | hypothetical protein | - |
| CGZ63_RS13405 | - | 2530129..2530611 (+) | 483 | WP_089607500.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CGZ63_RS13410 | - | 2530611..2531145 (+) | 535 | Protein_2508 | tyrosine-type recombinase/integrase | - |
| CGZ63_RS13415 | - | 2531420..2531878 (+) | 459 | WP_044797993.1 | hypothetical protein | - |
| CGZ63_RS13425 | - | 2532477..2532581 (+) | 105 | WP_157797745.1 | YjcZ family sporulation protein | - |
| CGZ63_RS13430 | - | 2532607..2532747 (+) | 141 | WP_089607502.1 | YjcZ family sporulation protein | - |
| CGZ63_RS13435 | - | 2532783..2533262 (+) | 480 | WP_232732734.1 | hypothetical protein | - |
| CGZ63_RS13440 | - | 2533676..2533903 (+) | 228 | WP_089607503.1 | hypothetical protein | - |
| CGZ63_RS32435 | - | 2533910..2534083 (+) | 174 | WP_198512961.1 | hypothetical protein | - |
| CGZ63_RS13445 | - | 2534076..2534411 (+) | 336 | WP_089607504.1 | HNH endonuclease | - |
| CGZ63_RS13450 | - | 2534531..2534842 (+) | 312 | WP_016125621.1 | P27 family phage terminase small subunit | - |
| CGZ63_RS13455 | - | 2534839..2536524 (+) | 1686 | WP_089607505.1 | terminase large subunit | - |
| CGZ63_RS13460 | - | 2536545..2537696 (+) | 1152 | WP_089607506.1 | phage portal protein | - |
| CGZ63_RS13465 | - | 2537686..2538411 (+) | 726 | WP_089607507.1 | head maturation protease, ClpP-related | - |
| CGZ63_RS13470 | - | 2538462..2539604 (+) | 1143 | WP_232732739.1 | phage major capsid protein | - |
| CGZ63_RS13475 | - | 2539617..2539910 (+) | 294 | WP_016125626.1 | hypothetical protein | - |
| CGZ63_RS13480 | - | 2539912..2540262 (+) | 351 | WP_023522880.1 | phage head closure protein | - |
| CGZ63_RS13485 | - | 2540264..2540605 (+) | 342 | WP_088054432.1 | HK97 gp10 family phage protein | - |
| CGZ63_RS13490 | - | 2540605..2540934 (+) | 330 | WP_089607509.1 | hypothetical protein | - |
| CGZ63_RS13495 | - | 2540935..2541522 (+) | 588 | WP_001004915.1 | major tail protein | - |
| CGZ63_RS13500 | - | 2541527..2541889 (+) | 363 | WP_089607510.1 | hypothetical protein | - |
| CGZ63_RS13510 | - | 2542120..2545740 (+) | 3621 | WP_089607512.1 | phage tail tape measure protein | - |
| CGZ63_RS13515 | - | 2545782..2547245 (+) | 1464 | WP_089607513.1 | distal tail protein Dit | - |
| CGZ63_RS13520 | - | 2547242..2551564 (+) | 4323 | WP_089607514.1 | phage tail spike protein | - |
| CGZ63_RS13525 | - | 2551576..2551956 (+) | 381 | WP_089607515.1 | hypothetical protein | - |
| CGZ63_RS13530 | - | 2551991..2552410 (+) | 420 | WP_089607516.1 | phage holin family protein | - |
| CGZ63_RS13535 | - | 2552410..2553342 (+) | 933 | WP_089607517.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 9992.61 Da Isoelectric Point: 6.4620
>NTDB_id=239556 CGZ63_RS13320 WP_089607488.1 2518392..2518670(+) (abrB) [Bacillus cereus C1L]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKQDKSCFVTGEVSGTNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKQDKSCFVTGEVSGTNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=239556 CGZ63_RS13320 WP_089607488.1 2518392..2518670(+) (abrB) [Bacillus cereus C1L]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTTTAAGAAAACAAGATAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGGAACCAACATAGAATTGCTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCTATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTTTAAGAAAACAAGATAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGGAACCAACATAGAATTGCTAGGTGGCCGAATGTTTTTGAGTAAGGAAGGGGCTATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
59.77 |
94.565 |
0.565 |