Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CFN60_RS12005 Genome accession   NZ_CP022341
Coordinates   2471798..2472175 (-) Length   125 a.a.
NCBI ID   WP_022552965.1    Uniprot ID   -
Organism   Bacillus velezensis strain 157     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2466798..2477175
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CFN60_RS11965 (CFN60_11960) - 2467295..2468089 (+) 795 WP_014418368.1 YqhG family protein -
  CFN60_RS11970 (CFN60_11965) sinI 2468266..2468439 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  CFN60_RS11975 (CFN60_11970) sinR 2468473..2468808 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CFN60_RS11980 (CFN60_11975) tasA 2468856..2469641 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CFN60_RS11985 (CFN60_11980) sipW 2469706..2470290 (-) 585 WP_022552967.1 signal peptidase I SipW -
  CFN60_RS11990 (CFN60_11985) tapA 2470262..2470933 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CFN60_RS11995 (CFN60_11990) - 2471192..2471521 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CFN60_RS12000 (CFN60_11995) - 2471562..2471741 (-) 180 WP_022552966.1 YqzE family protein -
  CFN60_RS12005 (CFN60_12000) comGG 2471798..2472175 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  CFN60_RS12010 (CFN60_12005) comGF 2472176..2472571 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  CFN60_RS12015 (CFN60_12010) comGE 2472585..2472899 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  CFN60_RS12020 (CFN60_12015) comGD 2472883..2473320 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CFN60_RS12025 (CFN60_12020) comGC 2473310..2473618 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  CFN60_RS12030 (CFN60_12025) comGB 2473623..2474660 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  CFN60_RS12035 (CFN60_12030) comGA 2474647..2475717 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  CFN60_RS12040 (CFN60_12035) - 2475910..2476860 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14207.16 Da        Isoelectric Point: 9.9338

>NTDB_id=238455 CFN60_RS12005 WP_022552965.1 2471798..2472175(-) (comGG) [Bacillus velezensis strain 157]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHINGSDRRETVQVTIQAETKTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=238455 CFN60_RS12005 WP_022552965.1 2471798..2472175(-) (comGG) [Bacillus velezensis strain 157]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCAACGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCAAGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment