Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CFN60_RS11970 | Genome accession | NZ_CP022341 |
| Coordinates | 2468266..2468439 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain 157 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2463266..2473439
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFN60_RS11955 (CFN60_11950) | gcvT | 2464079..2465179 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CFN60_RS11960 (CFN60_11955) | - | 2465603..2467273 (+) | 1671 | WP_038461530.1 | DEAD/DEAH box helicase | - |
| CFN60_RS11965 (CFN60_11960) | - | 2467295..2468089 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| CFN60_RS11970 (CFN60_11965) | sinI | 2468266..2468439 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| CFN60_RS11975 (CFN60_11970) | sinR | 2468473..2468808 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CFN60_RS11980 (CFN60_11975) | tasA | 2468856..2469641 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CFN60_RS11985 (CFN60_11980) | sipW | 2469706..2470290 (-) | 585 | WP_022552967.1 | signal peptidase I SipW | - |
| CFN60_RS11990 (CFN60_11985) | tapA | 2470262..2470933 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CFN60_RS11995 (CFN60_11990) | - | 2471192..2471521 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CFN60_RS12000 (CFN60_11995) | - | 2471562..2471741 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| CFN60_RS12005 (CFN60_12000) | comGG | 2471798..2472175 (-) | 378 | WP_022552965.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CFN60_RS12010 (CFN60_12005) | comGF | 2472176..2472571 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| CFN60_RS12015 (CFN60_12010) | comGE | 2472585..2472899 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CFN60_RS12020 (CFN60_12015) | comGD | 2472883..2473320 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=238453 CFN60_RS11970 WP_014418369.1 2468266..2468439(+) (sinI) [Bacillus velezensis strain 157]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=238453 CFN60_RS11970 WP_014418369.1 2468266..2468439(+) (sinI) [Bacillus velezensis strain 157]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |