Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CDO84_RS15215 Genome accession   NZ_CP021911
Coordinates   2995531..2995671 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. MD-5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2990531..3000671
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CDO84_RS15190 (CDO84_15190) - 2990881..2991261 (-) 381 WP_040081970.1 hotdog fold thioesterase -
  CDO84_RS15195 (CDO84_15195) comA 2991280..2991924 (-) 645 WP_088299198.1 two-component system response regulator ComA Regulator
  CDO84_RS15200 (CDO84_15200) comP 2992005..2994302 (-) 2298 WP_040081968.1 histidine kinase Regulator
  CDO84_RS15205 (CDO84_15205) comX 2994310..2994471 (-) 162 WP_003241045.1 competence pheromone ComX -
  CDO84_RS15210 (CDO84_15210) - 2994486..2995346 (-) 861 WP_040081966.1 polyprenyl synthetase family protein -
  CDO84_RS15215 (CDO84_15215) degQ 2995531..2995671 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  CDO84_RS21470 - 2995893..2996018 (+) 126 WP_128422565.1 hypothetical protein -
  CDO84_RS15220 (CDO84_15220) - 2996133..2996501 (+) 369 WP_014665193.1 hypothetical protein -
  CDO84_RS15225 (CDO84_15225) pdeH 2996477..2997706 (-) 1230 WP_014665194.1 cyclic di-GMP phosphodiesterase -
  CDO84_RS15230 (CDO84_15230) - 2997842..2999314 (-) 1473 WP_014665195.1 nicotinate phosphoribosyltransferase -
  CDO84_RS15235 (CDO84_15235) - 2999330..2999881 (-) 552 WP_014665196.1 isochorismatase family cysteine hydrolase -
  CDO84_RS15240 (CDO84_15240) - 2999978..3000376 (-) 399 WP_040081965.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=234824 CDO84_RS15215 WP_003220708.1 2995531..2995671(-) (degQ) [Bacillus sp. MD-5]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=234824 CDO84_RS15215 WP_003220708.1 2995531..2995671(-) (degQ) [Bacillus sp. MD-5]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment