Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   CD007_RS12150 Genome accession   NZ_CP021903
Coordinates   2381239..2381622 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain ge28     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2376239..2386622
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CD007_RS12110 (CD007_12110) sinI 2377173..2377346 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  CD007_RS12115 (CD007_12115) sinR 2377380..2377715 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CD007_RS12120 (CD007_12120) tasA 2377808..2378593 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  CD007_RS12125 (CD007_12125) sipW 2378657..2379229 (-) 573 WP_003246088.1 signal peptidase I SipW -
  CD007_RS12130 (CD007_12130) tapA 2379213..2379974 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  CD007_RS12135 (CD007_12135) yqzG 2380246..2380572 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  CD007_RS12140 (CD007_12140) spoIITA 2380614..2380793 (-) 180 WP_003230176.1 YqzE family protein -
  CD007_RS12145 (CD007_12145) comGG 2380864..2381238 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  CD007_RS12150 (CD007_12150) comGF 2381239..2381622 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  CD007_RS12155 (CD007_12155) comGE 2381648..2381995 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  CD007_RS12160 (CD007_12160) comGD 2381979..2382410 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  CD007_RS12165 (CD007_12165) comGC 2382400..2382696 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  CD007_RS12170 (CD007_12170) comGB 2382710..2383747 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  CD007_RS12175 (CD007_12175) comGA 2383734..2384804 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  CD007_RS12185 (CD007_12185) corA 2385215..2386168 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=234617 CD007_RS12150 WP_041850015.1 2381239..2381622(-) (comGF) [Bacillus subtilis strain ge28]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=234617 CD007_RS12150 WP_041850015.1 2381239..2381622(-) (comGF) [Bacillus subtilis strain ge28]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment