Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CD007_RS12110 Genome accession   NZ_CP021903
Coordinates   2377173..2377346 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ge28     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2372173..2382346
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CD007_RS12095 (CD007_12095) gcvT 2372973..2374061 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  CD007_RS12100 (CD007_12100) hepAA 2374502..2376175 (+) 1674 WP_041850014.1 SNF2-related protein -
  CD007_RS12105 (CD007_12105) yqhG 2376196..2376990 (+) 795 WP_003230200.1 YqhG family protein -
  CD007_RS12110 (CD007_12110) sinI 2377173..2377346 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  CD007_RS12115 (CD007_12115) sinR 2377380..2377715 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CD007_RS12120 (CD007_12120) tasA 2377808..2378593 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  CD007_RS12125 (CD007_12125) sipW 2378657..2379229 (-) 573 WP_003246088.1 signal peptidase I SipW -
  CD007_RS12130 (CD007_12130) tapA 2379213..2379974 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  CD007_RS12135 (CD007_12135) yqzG 2380246..2380572 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  CD007_RS12140 (CD007_12140) spoIITA 2380614..2380793 (-) 180 WP_003230176.1 YqzE family protein -
  CD007_RS12145 (CD007_12145) comGG 2380864..2381238 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  CD007_RS12150 (CD007_12150) comGF 2381239..2381622 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  CD007_RS12155 (CD007_12155) comGE 2381648..2381995 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=234614 CD007_RS12110 WP_003230187.1 2377173..2377346(+) (sinI) [Bacillus subtilis strain ge28]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=234614 CD007_RS12110 WP_003230187.1 2377173..2377346(+) (sinI) [Bacillus subtilis strain ge28]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment