Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S100141_RS00435 Genome accession   NZ_CP021669
Coordinates   86976..87116 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus licheniformis strain SRCM100141     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 81976..92116
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100141_RS00405 (S100141_00085) - 82280..82678 (+) 399 WP_087634936.1 YueI family protein -
  S100141_RS00410 (S100141_00086) - 82775..83326 (+) 552 WP_025853916.1 cysteine hydrolase family protein -
  S100141_RS00415 (S100141_00087) - 83344..84810 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  S100141_RS00420 (S100141_00088) - 84940..86163 (+) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  S100141_RS00425 (S100141_00089) - 86170..86511 (-) 342 WP_014418765.1 hypothetical protein -
  S100141_RS00435 (S100141_00090) degQ 86976..87116 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  S100141_RS00440 (S100141_00091) comQ 87247..88110 (+) 864 WP_269768362.1 class 1 isoprenoid biosynthesis enzyme Regulator
  S100141_RS00445 (S100141_00092) - 88184..88360 (+) 177 WP_087634937.1 competence pheromone ComX -
  S100141_RS00450 (S100141_00093) comP 88380..90689 (+) 2310 WP_087634938.1 histidine kinase Regulator
  S100141_RS00455 (S100141_00094) comA 90808..91413 (+) 606 WP_087634995.1 response regulator transcription factor Regulator
  S100141_RS00460 (S100141_00095) - 91435..91818 (+) 384 WP_017419422.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=232327 S100141_RS00435 WP_003152043.1 86976..87116(+) (degQ) [Bacillus licheniformis strain SRCM100141]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=232327 S100141_RS00435 WP_003152043.1 86976..87116(+) (degQ) [Bacillus licheniformis strain SRCM100141]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment