Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   S101441_RS13195 Genome accession   NZ_CP021507
Coordinates   2466313..2466687 (-) Length   124 a.a.
NCBI ID   WP_069837632.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain SRCM101441     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2461313..2471687
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101441_RS13155 (S101441_02652) yqhG 2461645..2462439 (+) 795 WP_014480249.1 YqhG family protein -
  S101441_RS13160 (S101441_02653) sinI 2462622..2462795 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  S101441_RS13165 (S101441_02654) sinR 2462829..2463164 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  S101441_RS13170 (S101441_02655) tasA 2463257..2464042 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  S101441_RS13175 (S101441_02656) sipW 2464106..2464678 (-) 573 WP_003230181.1 signal peptidase I SipW -
  S101441_RS13180 (S101441_02657) tapA 2464662..2465423 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  S101441_RS13185 (S101441_02658) yqzG 2465695..2466021 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  S101441_RS13190 (S101441_02659) spoIITA 2466063..2466242 (-) 180 WP_014480252.1 YqzE family protein -
  S101441_RS13195 (S101441_02660) comGG 2466313..2466687 (-) 375 WP_069837632.1 ComG operon protein ComGG Machinery gene
  S101441_RS13200 (S101441_02661) comGF 2466688..2467071 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  S101441_RS13205 (S101441_02662) comGE 2467097..2467444 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  S101441_RS13210 (S101441_02663) comGD 2467428..2467859 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  S101441_RS13215 (S101441_02664) comGC 2467849..2468145 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  S101441_RS13220 (S101441_02665) comGB 2468159..2469196 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  S101441_RS13225 (S101441_02666) comGA 2469183..2470253 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  S101441_RS13230 (S101441_02667) - 2470465..2470662 (-) 198 WP_014480259.1 CBS domain-containing protein -
  S101441_RS13235 (S101441_02668) corA 2470664..2471617 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=231475 S101441_RS13195 WP_069837632.1 2466313..2466687(-) (comGG) [Bacillus subtilis subsp. subtilis strain SRCM101441]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSLRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=231475 S101441_RS13195 WP_069837632.1 2466313..2466687(-) (comGG) [Bacillus subtilis subsp. subtilis strain SRCM101441]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGCTTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment