Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | S101441_RS13160 | Genome accession | NZ_CP021507 |
| Coordinates | 2462622..2462795 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain SRCM101441 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2457622..2467795
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S101441_RS13145 (S101441_02650) | gcvT | 2458422..2459510 (-) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| S101441_RS13150 (S101441_02651) | hepAA | 2459951..2461624 (+) | 1674 | WP_038829735.1 | SNF2-related protein | - |
| S101441_RS13155 (S101441_02652) | yqhG | 2461645..2462439 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| S101441_RS13160 (S101441_02653) | sinI | 2462622..2462795 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| S101441_RS13165 (S101441_02654) | sinR | 2462829..2463164 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| S101441_RS13170 (S101441_02655) | tasA | 2463257..2464042 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| S101441_RS13175 (S101441_02656) | sipW | 2464106..2464678 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| S101441_RS13180 (S101441_02657) | tapA | 2464662..2465423 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| S101441_RS13185 (S101441_02658) | yqzG | 2465695..2466021 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| S101441_RS13190 (S101441_02659) | spoIITA | 2466063..2466242 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| S101441_RS13195 (S101441_02660) | comGG | 2466313..2466687 (-) | 375 | WP_069837632.1 | ComG operon protein ComGG | Machinery gene |
| S101441_RS13200 (S101441_02661) | comGF | 2466688..2467071 (-) | 384 | WP_029317913.1 | ComG operon protein ComGF | Machinery gene |
| S101441_RS13205 (S101441_02662) | comGE | 2467097..2467444 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=231473 S101441_RS13160 WP_003230187.1 2462622..2462795(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM101441]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=231473 S101441_RS13160 WP_003230187.1 2462622..2462795(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM101441]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |