Detailed information NTG0231402

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: S101267_RS12720
• Genome accession: NZ_CP021505
• Coordinates: 2461636..2462073 (-)
• Length: 145 a.a.
• NCBI ID: WP_013352869.1
• Uniprot ID: A0A9P1JIH3
• Organism: Bacillus amyloliquefaciens strain SRCM101267
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2456636..2467073

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
S101267_RS12670 (S101267_02543)	sinI	2457022..2457195 (+)	174	WP_013352860.1	anti-repressor SinI	Regulator
S101267_RS12675 (S101267_02544)	sinR	2457229..2457564 (+)	336	WP_014470659.1	transcriptional regulator SinR	Regulator
S101267_RS12680 (S101267_02545)	tasA	2457612..2458397 (-)	786	WP_013352862.1	biofilm matrix protein TasA	-
S101267_RS12685 (S101267_02546)	sipW	2458462..2459046 (-)	585	WP_013352863.1	signal peptidase I SipW	-
S101267_RS12690 (S101267_02547)	tapA	2459018..2459689 (-)	672	WP_013352864.1	amyloid fiber anchoring/assembly protein TapA	-
S101267_RS12695 (S101267_02548)	-	2459947..2460276 (+)	330	WP_013352865.1	DUF3889 domain-containing protein	-
S101267_RS12700 (S101267_02549)	-	2460317..2460496 (-)	180	WP_013352866.1	YqzE family protein	-
S101267_RS12705 (S101267_02550)	comGG	2460550..2460927 (-)	378	WP_013352867.1	competence type IV pilus minor pilin ComGG	Machinery gene
S101267_RS12710	comGF	2460929..2461429 (-)	501	WP_013352868.1	competence type IV pilus minor pilin ComGF	-
S101267_RS12715 (S101267_02552)	comGE	2461338..2461652 (-)	315	WP_014470662.1	competence type IV pilus minor pilin ComGE	Machinery gene
S101267_RS12720 (S101267_02553)	comGD	2461636..2462073 (-)	438	WP_013352869.1	competence type IV pilus minor pilin ComGD	Machinery gene
S101267_RS12725 (S101267_02554)	comGC	2462063..2462371 (-)	309	WP_013352870.1	competence type IV pilus major pilin ComGC	Machinery gene
S101267_RS12730 (S101267_02555)	comGB	2462376..2463413 (-)	1038	WP_013352871.1	competence type IV pilus assembly protein ComGB	Machinery gene
S101267_RS12735 (S101267_02556)	comGA	2463400..2464470 (-)	1071	WP_013352872.1	competence type IV pilus ATPase ComGA	Machinery gene
S101267_RS12740 (S101267_02557)	-	2464664..2465614 (-)	951	WP_013352873.1	magnesium transporter CorA family protein	-
S101267_RS12745 (S101267_02558)	-	2465761..2467062 (+)	1302	WP_013352874.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16256.71 Da
• Isoelectric Point: 9.7141

>NTDB_id=231402 S101267_RS12720 WP_013352869.1 2461636..2462073(-) (comGD) [Bacillus amyloliquefaciens strain SRCM101267]
MNNNRLTENGFTLLESLVVLSLASVLLTVLFTAVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITIYLGSGNVHAERK

Nucleotide

• Length: 438 bp

>NTDB_id=231402 S101267_RS12720 WP_013352869.1 2461636..2462073(-) (comGD) [Bacillus amyloliquefaciens strain SRCM101267]
TTGAACAATAACCGGCTGACAGAAAACGGATTCACTCTTCTTGAAAGCCTGGTTGTGTTAAGTCTGGCGTCTGTATTGCT
GACTGTTTTGTTCACGGCGGTTCCGCCGGTTTATACCCATCTGGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGACA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACATTTCTCCCAAAAGAGCATAAATACAAG
CTGCAGTCAGCCGGAAGGATTGTTGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCCGGCGGAAAGATTCAATTGAAAAGCGCGGGATTCACTTATGAAATAACAATTT
ACTTAGGGAGCGGAAATGTCCATGCAGAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.115	95.862	0.538