Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   S101267_RS12670 Genome accession   NZ_CP021505
Coordinates   2457022..2457195 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain SRCM101267     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2452022..2462195
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101267_RS12655 (S101267_02540) gcvT 2452833..2453933 (-) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -
  S101267_RS12660 (S101267_02541) - 2454357..2456027 (+) 1671 WP_014470658.1 DEAD/DEAH box helicase -
  S101267_RS12665 (S101267_02542) - 2456048..2456842 (+) 795 WP_013352859.1 YqhG family protein -
  S101267_RS12670 (S101267_02543) sinI 2457022..2457195 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  S101267_RS12675 (S101267_02544) sinR 2457229..2457564 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  S101267_RS12680 (S101267_02545) tasA 2457612..2458397 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  S101267_RS12685 (S101267_02546) sipW 2458462..2459046 (-) 585 WP_013352863.1 signal peptidase I SipW -
  S101267_RS12690 (S101267_02547) tapA 2459018..2459689 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  S101267_RS12695 (S101267_02548) - 2459947..2460276 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  S101267_RS12700 (S101267_02549) - 2460317..2460496 (-) 180 WP_013352866.1 YqzE family protein -
  S101267_RS12705 (S101267_02550) comGG 2460550..2460927 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  S101267_RS12710 comGF 2460929..2461429 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  S101267_RS12715 (S101267_02552) comGE 2461338..2461652 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  S101267_RS12720 (S101267_02553) comGD 2461636..2462073 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=231398 S101267_RS12670 WP_013352860.1 2457022..2457195(+) (sinI) [Bacillus amyloliquefaciens strain SRCM101267]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=231398 S101267_RS12670 WP_013352860.1 2457022..2457195(+) (sinI) [Bacillus amyloliquefaciens strain SRCM101267]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684


Multiple sequence alignment