Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   S101267_RS12715 Genome accession   NZ_CP021505
Coordinates   2461338..2461652 (-) Length   104 a.a.
NCBI ID   WP_014470662.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain SRCM101267     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2456338..2466652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101267_RS12670 (S101267_02543) sinI 2457022..2457195 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  S101267_RS12675 (S101267_02544) sinR 2457229..2457564 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  S101267_RS12680 (S101267_02545) tasA 2457612..2458397 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  S101267_RS12685 (S101267_02546) sipW 2458462..2459046 (-) 585 WP_013352863.1 signal peptidase I SipW -
  S101267_RS12690 (S101267_02547) tapA 2459018..2459689 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  S101267_RS12695 (S101267_02548) - 2459947..2460276 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  S101267_RS12700 (S101267_02549) - 2460317..2460496 (-) 180 WP_013352866.1 YqzE family protein -
  S101267_RS12705 (S101267_02550) comGG 2460550..2460927 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  S101267_RS12710 comGF 2460929..2461429 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  S101267_RS12715 (S101267_02552) comGE 2461338..2461652 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  S101267_RS12720 (S101267_02553) comGD 2461636..2462073 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  S101267_RS12725 (S101267_02554) comGC 2462063..2462371 (-) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  S101267_RS12730 (S101267_02555) comGB 2462376..2463413 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  S101267_RS12735 (S101267_02556) comGA 2463400..2464470 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  S101267_RS12740 (S101267_02557) - 2464664..2465614 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11934.89 Da        Isoelectric Point: 6.2120

>NTDB_id=231401 S101267_RS12715 WP_014470662.1 2461338..2461652(-) (comGE) [Bacillus amyloliquefaciens strain SRCM101267]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEEHQEVYQLLHKHISAYMMSGKKQPSPDVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=231401 S101267_RS12715 WP_014470662.1 2461338..2461652(-) (comGE) [Bacillus amyloliquefaciens strain SRCM101267]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACACCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCATCTCCCGATGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment