Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S101359_RS15840 Genome accession   NZ_CP021500
Coordinates   3194264..3194407 (-) Length   47 a.a.
NCBI ID   WP_003327149.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SRCM101359     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3189264..3199407
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101359_RS15815 (S101359_03122) - 3189621..3190001 (-) 381 WP_088117876.1 hotdog fold thioesterase -
  S101359_RS15820 (S101359_03123) comA 3190019..3190660 (-) 642 WP_003327154.1 response regulator transcription factor Regulator
  S101359_RS15825 (S101359_03124) comP 3190741..3193035 (-) 2295 WP_088117877.1 histidine kinase Regulator
  S101359_RS15830 (S101359_03125) comX 3193043..3193204 (-) 162 WP_010789788.1 competence pheromone ComX -
  S101359_RS15835 (S101359_03126) - 3193220..3194080 (-) 861 WP_088118513.1 polyprenyl synthetase family protein -
  S101359_RS15840 (S101359_03127) degQ 3194264..3194407 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  S101359_RS15845 (S101359_03128) - 3194867..3195226 (+) 360 WP_088117878.1 hypothetical protein -
  S101359_RS15850 (S101359_03129) - 3195245..3196477 (-) 1233 WP_003327147.1 EAL and HDOD domain-containing protein -
  S101359_RS15855 (S101359_03130) - 3196615..3198081 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -
  S101359_RS15860 (S101359_03131) - 3198097..3198648 (-) 552 WP_063637896.1 isochorismatase family cysteine hydrolase -
  S101359_RS15865 (S101359_03132) - 3198756..3199154 (-) 399 WP_003327144.1 YueI family protein -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5645.61 Da        Isoelectric Point: 8.5787

>NTDB_id=231317 S101359_RS15840 WP_003327149.1 3194264..3194407(-) (degQ) [Bacillus atrophaeus strain SRCM101359]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 144 bp        

>NTDB_id=231317 S101359_RS15840 WP_003327149.1 3194264..3194407(-) (degQ) [Bacillus atrophaeus strain SRCM101359]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.455

93.617

0.894

Multiple sequence alignment