Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | S101444_RS12700 | Genome accession | NZ_CP021498 |
| Coordinates | 2368706..2368879 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain SRCM101444 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2363706..2373879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S101444_RS12685 (S101444_02524) | gcvT | 2364505..2365593 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| S101444_RS12690 (S101444_02525) | hepAA | 2366035..2367708 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| S101444_RS12695 (S101444_02526) | yqhG | 2367729..2368523 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| S101444_RS12700 (S101444_02527) | sinI | 2368706..2368879 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| S101444_RS12705 (S101444_02528) | sinR | 2368913..2369248 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| S101444_RS12710 (S101444_02529) | tasA | 2369341..2370126 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| S101444_RS12715 (S101444_02530) | sipW | 2370190..2370762 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| S101444_RS12720 (S101444_02531) | tapA | 2370746..2371507 (-) | 762 | WP_087614619.1 | amyloid fiber anchoring/assembly protein TapA | - |
| S101444_RS12725 (S101444_02532) | yqzG | 2371779..2372105 (+) | 327 | WP_029317915.1 | YqzG/YhdC family protein | - |
| S101444_RS12730 (S101444_02533) | spoIITA | 2372147..2372326 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| S101444_RS12735 (S101444_02534) | comGG | 2372397..2372771 (-) | 375 | WP_015714252.1 | ComG operon protein ComGG | Machinery gene |
| S101444_RS12740 (S101444_02535) | comGF | 2372772..2373155 (-) | 384 | WP_076458111.1 | ComG operon protein ComGF | Machinery gene |
| S101444_RS12745 (S101444_02536) | comGE | 2373181..2373528 (-) | 348 | WP_087614620.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=231134 S101444_RS12700 WP_003230187.1 2368706..2368879(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM101444]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=231134 S101444_RS12700 WP_003230187.1 2368706..2368879(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM101444]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |