Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   S101444_RS12740 Genome accession   NZ_CP021498
Coordinates   2372772..2373155 (-) Length   127 a.a.
NCBI ID   WP_076458111.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain SRCM101444     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2367772..2378155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101444_RS12700 (S101444_02527) sinI 2368706..2368879 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  S101444_RS12705 (S101444_02528) sinR 2368913..2369248 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  S101444_RS12710 (S101444_02529) tasA 2369341..2370126 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  S101444_RS12715 (S101444_02530) sipW 2370190..2370762 (-) 573 WP_003230181.1 signal peptidase I SipW -
  S101444_RS12720 (S101444_02531) tapA 2370746..2371507 (-) 762 WP_087614619.1 amyloid fiber anchoring/assembly protein TapA -
  S101444_RS12725 (S101444_02532) yqzG 2371779..2372105 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  S101444_RS12730 (S101444_02533) spoIITA 2372147..2372326 (-) 180 WP_014480252.1 YqzE family protein -
  S101444_RS12735 (S101444_02534) comGG 2372397..2372771 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  S101444_RS12740 (S101444_02535) comGF 2372772..2373155 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  S101444_RS12745 (S101444_02536) comGE 2373181..2373528 (-) 348 WP_087614620.1 ComG operon protein 5 Machinery gene
  S101444_RS12750 (S101444_02537) comGD 2373512..2373943 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  S101444_RS12755 (S101444_02538) comGC 2373933..2374229 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  S101444_RS12760 (S101444_02539) comGB 2374243..2375280 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  S101444_RS12765 (S101444_02540) comGA 2375267..2376337 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  S101444_RS12770 (S101444_02541) - 2376549..2376746 (-) 198 WP_014480259.1 CBS domain-containing protein -
  S101444_RS12775 (S101444_02542) corA 2376748..2377701 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14448.54 Da        Isoelectric Point: 6.2135

>NTDB_id=231137 S101444_RS12740 WP_076458111.1 2372772..2373155(-) (comGF) [Bacillus subtilis subsp. subtilis strain SRCM101444]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=231137 S101444_RS12740 WP_076458111.1 2372772..2373155(-) (comGF) [Bacillus subtilis subsp. subtilis strain SRCM101444]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.413

99.213

0.976

Multiple sequence alignment