Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   B9N48_RS12395 Genome accession   NZ_CP021169
Coordinates   2382830..2383213 (-) Length   127 a.a.
NCBI ID   WP_024573389.1    Uniprot ID   -
Organism   Bacillus subtilis strain TLO3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2377830..2388213
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9N48_RS12355 sinI 2378763..2378936 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  B9N48_RS12360 sinR 2378970..2379305 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  B9N48_RS12365 tasA 2379398..2380183 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  B9N48_RS12370 sipW 2380247..2380819 (-) 573 WP_086344613.1 signal peptidase I SipW -
  B9N48_RS12375 tapA 2380803..2381564 (-) 762 WP_086344079.1 amyloid fiber anchoring/assembly protein TapA -
  B9N48_RS12380 yqzG 2381837..2382163 (+) 327 WP_086344614.1 YqzG/YhdC family protein -
  B9N48_RS12385 spoIITA 2382205..2382384 (-) 180 WP_003230176.1 YqzE family protein -
  B9N48_RS12390 comGG 2382455..2382829 (-) 375 WP_086344080.1 ComG operon protein ComGG Machinery gene
  B9N48_RS12395 comGF 2382830..2383213 (-) 384 WP_024573389.1 ComG operon protein ComGF Machinery gene
  B9N48_RS12400 comGE 2383239..2383586 (-) 348 WP_086344081.1 ComG operon protein 5 Machinery gene
  B9N48_RS12405 comGD 2383570..2384001 (-) 432 WP_086344082.1 comG operon protein ComGD Machinery gene
  B9N48_RS12410 comGC 2383991..2384287 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  B9N48_RS12415 comGB 2384301..2385338 (-) 1038 WP_086344083.1 comG operon protein ComGB Machinery gene
  B9N48_RS12420 comGA 2385325..2386395 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  B9N48_RS12425 - 2386606..2386803 (-) 198 WP_032726162.1 hypothetical protein -
  B9N48_RS12430 corA 2386805..2387758 (-) 954 WP_072173930.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14328.48 Da        Isoelectric Point: 6.4842

>NTDB_id=228773 B9N48_RS12395 WP_024573389.1 2382830..2383213(-) (comGF) [Bacillus subtilis strain TLO3]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=228773 B9N48_RS12395 WP_024573389.1 2382830..2383213(-) (comGF) [Bacillus subtilis strain TLO3]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment