Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   B9N48_RS12355 Genome accession   NZ_CP021169
Coordinates   2378763..2378936 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain TLO3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2373763..2383936
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9N48_RS12340 gcvT 2374562..2375650 (-) 1089 WP_086344077.1 glycine cleavage system aminomethyltransferase GcvT -
  B9N48_RS12345 hepAA 2376092..2377765 (+) 1674 WP_004398544.1 SNF2-related protein -
  B9N48_RS12350 yqhG 2377786..2378580 (+) 795 WP_086344078.1 YqhG family protein -
  B9N48_RS12355 sinI 2378763..2378936 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  B9N48_RS12360 sinR 2378970..2379305 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  B9N48_RS12365 tasA 2379398..2380183 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  B9N48_RS12370 sipW 2380247..2380819 (-) 573 WP_086344613.1 signal peptidase I SipW -
  B9N48_RS12375 tapA 2380803..2381564 (-) 762 WP_086344079.1 amyloid fiber anchoring/assembly protein TapA -
  B9N48_RS12380 yqzG 2381837..2382163 (+) 327 WP_086344614.1 YqzG/YhdC family protein -
  B9N48_RS12385 spoIITA 2382205..2382384 (-) 180 WP_003230176.1 YqzE family protein -
  B9N48_RS12390 comGG 2382455..2382829 (-) 375 WP_086344080.1 ComG operon protein ComGG Machinery gene
  B9N48_RS12395 comGF 2382830..2383213 (-) 384 WP_024573389.1 ComG operon protein ComGF Machinery gene
  B9N48_RS12400 comGE 2383239..2383586 (-) 348 WP_086344081.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=228770 B9N48_RS12355 WP_003230187.1 2378763..2378936(+) (sinI) [Bacillus subtilis strain TLO3]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=228770 B9N48_RS12355 WP_003230187.1 2378763..2378936(+) (sinI) [Bacillus subtilis strain TLO3]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment