Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   CA207_RS05435 Genome accession   NZ_CP021058
Coordinates   1067511..1067993 (+) Length   160 a.a.
NCBI ID   WP_086038608.1    Uniprot ID   -
Organism   Macrococcoides caseolyticum strain IMD0819     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1059757..1098228 1067511..1067993 within 0


Gene organization within MGE regions


Location: 1059757..1098228
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CA207_RS05355 (CA207_11070) - 1059757..1060923 (-) 1167 WP_086038599.1 tyrosine-type recombinase/integrase -
  CA207_RS05360 (CA207_11080) - 1060993..1061619 (-) 627 WP_157820203.1 DUF4352 domain-containing protein -
  CA207_RS05365 (CA207_11090) - 1061679..1062164 (-) 486 WP_086038601.1 ImmA/IrrE family metallo-endopeptidase -
  CA207_RS05370 (CA207_11100) - 1062177..1062602 (-) 426 WP_232755764.1 helix-turn-helix domain-containing protein -
  CA207_RS05375 (CA207_11110) - 1062690..1062899 (+) 210 WP_086038309.1 helix-turn-helix domain-containing protein -
  CA207_RS05380 (CA207_11120) - 1062943..1063212 (+) 270 WP_086038310.1 hypothetical protein -
  CA207_RS05385 (CA207_11130) - 1063209..1063397 (+) 189 WP_086038311.1 hypothetical protein -
  CA207_RS05390 (CA207_11150) - 1063490..1064242 (+) 753 WP_162485202.1 BRO family protein -
  CA207_RS05395 (CA207_11160) - 1064232..1064504 (+) 273 WP_086038313.1 hypothetical protein -
  CA207_RS05400 (CA207_11170) - 1064485..1065492 (+) 1008 WP_086038602.1 DnaD domain protein -
  CA207_RS05405 (CA207_11180) - 1065473..1065787 (+) 315 WP_162485204.1 hypothetical protein -
  CA207_RS05410 (CA207_11190) - 1065789..1065980 (+) 192 WP_086038603.1 hypothetical protein -
  CA207_RS05415 (CA207_11200) - 1065955..1066155 (-) 201 WP_086038604.1 hypothetical protein -
  CA207_RS05420 (CA207_11220) - 1066337..1066537 (-) 201 WP_086038605.1 hypothetical protein -
  CA207_RS05425 (CA207_11230) - 1066629..1066958 (+) 330 WP_086038606.1 hypothetical protein -
  CA207_RS05430 (CA207_11240) - 1066997..1067518 (+) 522 WP_086038607.1 HNH endonuclease -
  CA207_RS05435 (CA207_11250) ssbA 1067511..1067993 (+) 483 WP_086038608.1 single-stranded DNA-binding protein Machinery gene
  CA207_RS05440 (CA207_11260) - 1068007..1068348 (+) 342 WP_086038609.1 hypothetical protein -
  CA207_RS05445 (CA207_11270) - 1068359..1068607 (+) 249 WP_086038610.1 hypothetical protein -
  CA207_RS05450 (CA207_11280) - 1068620..1068862 (+) 243 WP_086038611.1 hypothetical protein -
  CA207_RS05455 (CA207_11290) - 1068876..1069409 (+) 534 WP_086038612.1 MazG-like family protein -
  CA207_RS05460 (CA207_11310) - 1069604..1070116 (+) 513 WP_086038613.1 Holliday junction resolvase RecU -
  CA207_RS12155 (CA207_11320) - 1070127..1070279 (+) 153 WP_157819807.1 hypothetical protein -
  CA207_RS05465 (CA207_11330) - 1070477..1070926 (+) 450 WP_086038614.1 ArpU family phage packaging/lysis transcriptional regulator -
  CA207_RS05470 (CA207_11340) - 1070926..1071474 (+) 549 WP_086038615.1 site-specific integrase -
  CA207_RS05475 (CA207_11350) - 1071683..1072123 (+) 441 WP_086038616.1 hypothetical protein -
  CA207_RS05480 (CA207_11360) - 1072252..1072629 (+) 378 WP_235606501.1 HNH endonuclease signature motif containing protein -
  CA207_RS05485 (CA207_11370) - 1072762..1073247 (+) 486 WP_012657433.1 phage terminase small subunit P27 family -
  CA207_RS05490 (CA207_11380) - 1073244..1074950 (+) 1707 WP_086038617.1 terminase large subunit -
  CA207_RS12160 (CA207_11390) - 1074947..1075120 (+) 174 WP_157827310.1 hypothetical protein -
  CA207_RS05495 (CA207_11400) - 1075202..1076365 (+) 1164 WP_162485211.1 phage portal protein -
  CA207_RS05500 (CA207_11410) - 1076349..1076918 (+) 570 WP_041636125.1 HK97 family phage prohead protease -
  CA207_RS05505 (CA207_11420) - 1076928..1078061 (+) 1134 WP_086038619.1 phage major capsid protein -
  CA207_RS05510 (CA207_11430) - 1078076..1078282 (+) 207 WP_086038620.1 hypothetical protein -
  CA207_RS05515 (CA207_11440) - 1078263..1078598 (+) 336 WP_041636122.1 head-tail connector protein -
  CA207_RS05520 (CA207_11450) - 1078567..1078890 (+) 324 WP_012657427.1 head-tail adaptor protein -
  CA207_RS05525 (CA207_11460) - 1078887..1079279 (+) 393 WP_012657426.1 HK97-gp10 family putative phage morphogenesis protein -
  CA207_RS05530 (CA207_11470) - 1079276..1079665 (+) 390 WP_086038621.1 hypothetical protein -
  CA207_RS05535 (CA207_11480) - 1079678..1080265 (+) 588 WP_012657424.1 major tail protein -
  CA207_RS05540 (CA207_11490) gpG 1080336..1080689 (+) 354 WP_012657423.1 phage tail assembly chaperone G -
  CA207_RS12165 (CA207_11500) - 1080749..1080898 (+) 150 WP_158298083.1 hypothetical protein -
  CA207_RS05545 (CA207_11510) - 1080923..1085284 (+) 4362 WP_086038622.1 peptidoglycan DD-metalloendopeptidase family protein -
  CA207_RS05550 (CA207_11520) - 1085294..1086814 (+) 1521 WP_086038623.1 phage distal tail protein -
  CA207_RS05555 (CA207_11530) - 1086830..1090174 (+) 3345 WP_086038624.1 phage tail spike protein -
  CA207_RS05560 (CA207_11540) - 1090176..1090574 (+) 399 WP_086038625.1 hypothetical protein -
  CA207_RS12170 (CA207_11550) - 1090558..1090728 (+) 171 WP_157820106.1 hypothetical protein -
  CA207_RS05565 (CA207_11560) - 1090773..1091060 (+) 288 WP_086038626.1 hypothetical protein -
  CA207_RS05570 (CA207_11570) - 1091075..1091587 (+) 513 WP_086038627.1 holin family protein -
  CA207_RS05575 (CA207_11580) - 1091645..1092469 (+) 825 WP_235606505.1 N-acetylmuramoyl-L-alanine amidase -
  CA207_RS05580 (CA207_11590) - 1092704..1093000 (+) 297 WP_086038628.1 hypothetical protein -
  CA207_RS05585 (CA207_11600) - 1092990..1093391 (+) 402 WP_086038629.1 hypothetical protein -
  CA207_RS05590 (CA207_11610) - 1093354..1093605 (+) 252 WP_086038630.1 hypothetical protein -
  CA207_RS05595 (CA207_11620) - 1094043..1095002 (+) 960 WP_086037795.1 IS30 family transposase -
  CA207_RS05600 (CA207_11630) - 1095036..1095461 (+) 426 WP_086038631.1 hypothetical protein -
  CA207_RS05605 (CA207_11640) - 1095932..1096321 (-) 390 WP_086038632.1 hypothetical protein -
  CA207_RS05610 (CA207_11650) - 1096589..1097092 (+) 504 WP_086038633.1 hypothetical protein -
  CA207_RS05615 (CA207_11660) - 1097269..1098228 (+) 960 WP_086037795.1 IS30 family transposase -

Sequence


Protein


Download         Length: 160 a.a.        Molecular weight: 17966.81 Da        Isoelectric Point: 4.9587

>NTDB_id=227988 CA207_RS05435 WP_086038608.1 1067511..1067993(+) (ssbA) [Macrococcoides caseolyticum strain IMD0819]
MINRVVLVGRLTADPQYRVTPSGVSVATFTLAINRTFTNAQGERQADFINCIVFRKQAENVNTYLHKGSLAGVDGRLQSR
SYDNQEGRRVYVTEVVCESVQFLEPKNSRNGADHYDDYPQAQQTNDYATREKKAQETMPTNNPFANADGPIDISDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=227988 CA207_RS05435 WP_086038608.1 1067511..1067993(+) (ssbA) [Macrococcoides caseolyticum strain IMD0819]
ATGATTAATCGAGTTGTGCTTGTAGGAAGGCTTACGGCTGATCCACAATATCGCGTAACACCATCAGGAGTTTCGGTAGC
AACCTTTACACTTGCAATCAATCGTACATTCACTAATGCACAAGGCGAGCGACAAGCAGACTTTATAAACTGCATCGTAT
TCAGAAAGCAAGCAGAAAACGTAAATACTTATCTACACAAAGGAAGTTTAGCTGGAGTCGATGGAAGATTACAATCACGT
AGCTATGACAATCAAGAAGGTAGACGAGTATATGTAACTGAAGTTGTATGTGAATCAGTTCAATTCCTAGAACCGAAGAA
TTCAAGAAATGGTGCAGATCACTATGATGATTATCCGCAAGCTCAGCAAACTAACGATTATGCAACTCGTGAGAAAAAGG
CACAAGAAACAATGCCTACTAATAATCCATTTGCTAATGCCGATGGGCCAATAGATATTAGTGATGATGATTTACCGTTT
TAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

56.977

100

0.613

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.544

  ssbB Bacillus subtilis subsp. subtilis str. 168

55.752

70.625

0.394


Multiple sequence alignment