Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   B6257_RS02135 Genome accession   NZ_CP021011
Coordinates   415391..415705 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain GFP-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 410391..420705
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B6257_RS02090 (B6257_02075) sinI 411074..411247 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  B6257_RS02095 (B6257_02080) sinR 411281..411616 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  B6257_RS02100 (B6257_02085) tasA 411664..412449 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  B6257_RS02105 (B6257_02090) sipW 412513..413097 (-) 585 WP_101562270.1 signal peptidase I SipW -
  B6257_RS02110 (B6257_02095) tapA 413069..413740 (-) 672 WP_101562271.1 amyloid fiber anchoring/assembly protein TapA -
  B6257_RS02115 (B6257_02100) - 413999..414328 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  B6257_RS02120 (B6257_02105) - 414368..414547 (-) 180 WP_003153093.1 YqzE family protein -
  B6257_RS02125 (B6257_02110) comGG 414604..414981 (-) 378 WP_101562272.1 competence type IV pilus minor pilin ComGG Machinery gene
  B6257_RS02130 (B6257_02115) comGF 414982..415482 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  B6257_RS02135 (B6257_02120) comGE 415391..415705 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  B6257_RS02140 (B6257_02125) comGD 415689..416126 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  B6257_RS02145 (B6257_02130) comGC 416116..416382 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  B6257_RS02150 (B6257_02135) comGB 416429..417466 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  B6257_RS02155 (B6257_02140) comGA 417453..418523 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  B6257_RS02160 (B6257_02145) - 418714..419664 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=227779 B6257_RS02135 WP_015388003.1 415391..415705(-) (comGE) [Bacillus velezensis strain GFP-2]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=227779 B6257_RS02135 WP_015388003.1 415391..415705(-) (comGE) [Bacillus velezensis strain GFP-2]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAGC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment