Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | B6257_RS02090 | Genome accession | NZ_CP021011 |
| Coordinates | 411074..411247 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain GFP-2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 406074..416247
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B6257_RS02075 (B6257_02060) | gcvT | 406891..407991 (-) | 1101 | WP_071391617.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| B6257_RS02080 (B6257_02065) | - | 408415..410085 (+) | 1671 | WP_101562269.1 | DEAD/DEAH box helicase | - |
| B6257_RS02085 (B6257_02070) | - | 410103..410897 (+) | 795 | WP_071391615.1 | YqhG family protein | - |
| B6257_RS02090 (B6257_02075) | sinI | 411074..411247 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| B6257_RS02095 (B6257_02080) | sinR | 411281..411616 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| B6257_RS02100 (B6257_02085) | tasA | 411664..412449 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| B6257_RS02105 (B6257_02090) | sipW | 412513..413097 (-) | 585 | WP_101562270.1 | signal peptidase I SipW | - |
| B6257_RS02110 (B6257_02095) | tapA | 413069..413740 (-) | 672 | WP_101562271.1 | amyloid fiber anchoring/assembly protein TapA | - |
| B6257_RS02115 (B6257_02100) | - | 413999..414328 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| B6257_RS02120 (B6257_02105) | - | 414368..414547 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| B6257_RS02125 (B6257_02110) | comGG | 414604..414981 (-) | 378 | WP_101562272.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| B6257_RS02130 (B6257_02115) | comGF | 414982..415482 (-) | 501 | WP_014305411.1 | competence type IV pilus minor pilin ComGF | - |
| B6257_RS02135 (B6257_02120) | comGE | 415391..415705 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| B6257_RS02140 (B6257_02125) | comGD | 415689..416126 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=227776 B6257_RS02090 WP_003153105.1 411074..411247(+) (sinI) [Bacillus velezensis strain GFP-2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=227776 B6257_RS02090 WP_003153105.1 411074..411247(+) (sinI) [Bacillus velezensis strain GFP-2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |