Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   B7941_RS04565 Genome accession   NZ_CP020805
Coordinates   900501..900620 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain 9D-6     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 895501..905620
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B7941_RS04550 (B7941_04550) - 897113..897796 (+) 684 WP_007410267.1 response regulator transcription factor -
  B7941_RS04555 (B7941_04555) - 897783..899216 (+) 1434 WP_161968256.1 sensor histidine kinase -
  B7941_RS04560 (B7941_04560) rapC 899369..900517 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  B7941_RS04565 (B7941_04565) phrC 900501..900620 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  B7941_RS04570 (B7941_04570) - 900768..900878 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  B7941_RS04575 (B7941_04575) - 900958..902322 (-) 1365 WP_059366589.1 aspartate kinase -
  B7941_RS04580 (B7941_04580) ceuB 902736..903689 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  B7941_RS04585 (B7941_04585) - 903679..904626 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  B7941_RS04590 (B7941_04590) - 904620..905378 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=225928 B7941_RS04565 WP_003156334.1 900501..900620(+) (phrC) [Bacillus velezensis strain 9D-6]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=225928 B7941_RS04565 WP_003156334.1 900501..900620(+) (phrC) [Bacillus velezensis strain 9D-6]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment