Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SPYM18_RS00665 Genome accession   NC_003485
Coordinates   104747..105031 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes MGAS8232     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99747..110031
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPYM18_RS00640 (spyM18_0101) - 101694..102059 (+) 366 WP_002986560.1 DUF1033 family protein -
  SPYM18_RS00645 (spyM18_0102) comGA 102151..103089 (+) 939 WP_002986557.1 competence type IV pilus ATPase ComGA Machinery gene
  SPYM18_RS00650 (spyM18_0103) comGB 103025..104059 (+) 1035 WP_226976794.1 competence type IV pilus assembly protein ComGB Machinery gene
  SPYM18_RS00655 (spyM18_0105) comGC 104061..104387 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  SPYM18_RS00660 (spyM18_0106) comGD 104362..104790 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  SPYM18_RS00665 (spyM18_0107) comGE 104747..105031 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  SPYM18_RS00670 (spyM18_0108) comGF 105024..105458 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  SPYM18_RS00675 (spyM18_0109) comGG 105442..105768 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  SPYM18_RS00680 (spyM18_0110) comGH 105866..106819 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  SPYM18_RS00685 (spyM18_0111) - 106878..108074 (+) 1197 WP_002986533.1 acetate kinase -
  SPYM18_RS00690 (spyM18_0112) - 108261..108569 (+) 309 WP_011017251.1 hypothetical protein -
  SPYM18_RS00695 (spyM18_0113) proC 108652..109422 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=22539 SPYM18_RS00665 WP_002987779.1 104747..105031(+) (comGE) [Streptococcus pyogenes MGAS8232]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=22539 SPYM18_RS00665 WP_002987779.1 104747..105031(+) (comGE) [Streptococcus pyogenes MGAS8232]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment