Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   B4U56_RS08980 Genome accession   NZ_CP020463
Coordinates   1835122..1835697 (-) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 1457     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1794046..1834721 1835122..1835697 flank 401


Gene organization within MGE regions


Location: 1794046..1835697
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B4U56_RS08710 (B4U56_08705) - 1794046..1795509 (-) 1464 WP_032606340.1 SH3 domain-containing protein -
  B4U56_RS08715 (B4U56_08710) - 1795484..1795894 (-) 411 WP_002502079.1 phage holin -
  B4U56_RS08720 (B4U56_08715) - 1795958..1796356 (-) 399 WP_032606342.1 YxeA family protein -
  B4U56_RS08725 (B4U56_08720) - 1796514..1796921 (-) 408 WP_002502077.1 hypothetical protein -
  B4U56_RS08730 (B4U56_08725) - 1796908..1797333 (-) 426 WP_002502076.1 hypothetical protein -
  B4U56_RS08735 (B4U56_08730) - 1797330..1797953 (-) 624 WP_032606043.1 poly-gamma-glutamate hydrolase family protein -
  B4U56_RS08740 (B4U56_08735) - 1797958..1799172 (-) 1215 WP_002502074.1 BppU family phage baseplate upper protein -
  B4U56_RS08745 (B4U56_08740) - 1799172..1801034 (-) 1863 WP_002502073.1 M14 family metallopeptidase -
  B4U56_RS12500 - 1801050..1801223 (-) 174 WP_002502072.1 hypothetical protein -
  B4U56_RS08750 (B4U56_08745) - 1801216..1802775 (-) 1560 WP_002502071.1 prophage endopeptidase tail family protein -
  B4U56_RS08755 (B4U56_08750) - 1802785..1803618 (-) 834 WP_002502070.1 phage tail domain-containing protein -
  B4U56_RS08760 (B4U56_08755) - 1803620..1808331 (-) 4712 Protein_1623 phage tail tape measure protein -
  B4U56_RS12405 gpGT 1808360..1808512 (-) 153 WP_002502068.1 phage tail assembly chaperone GT -
  B4U56_RS08765 (B4U56_08760) gpG 1808545..1808907 (-) 363 WP_002502067.1 phage tail assembly chaperone G -
  B4U56_RS08770 (B4U56_08765) - 1808971..1809156 (-) 186 WP_002502066.1 hypothetical protein -
  B4U56_RS08775 (B4U56_08770) - 1809175..1809801 (-) 627 WP_002502065.1 major tail protein -
  B4U56_RS08780 (B4U56_08775) - 1809814..1810218 (-) 405 WP_002502064.1 hypothetical protein -
  B4U56_RS08785 (B4U56_08780) - 1810221..1810487 (-) 267 WP_002502063.1 hypothetical protein -
  B4U56_RS08790 (B4U56_08785) - 1810622..1810951 (-) 330 WP_002502062.1 head-tail adaptor protein -
  B4U56_RS08795 (B4U56_08790) - 1810941..1811282 (-) 342 WP_002502061.1 head-tail connector protein -
  B4U56_RS08800 (B4U56_08795) - 1811301..1812626 (-) 1326 WP_002502060.1 phage major capsid protein -
  B4U56_RS08805 (B4U56_08800) - 1812668..1813225 (-) 558 WP_002497603.1 HK97 family phage prohead protease -
  B4U56_RS08810 (B4U56_08805) - 1813215..1814447 (-) 1233 WP_002502059.1 phage portal protein -
  B4U56_RS12755 (B4U56_08810) - 1814447..1814641 (-) 195 WP_002502058.1 hypothetical protein -
  B4U56_RS08820 (B4U56_08815) - 1814657..1816408 (-) 1752 WP_002502057.1 terminase large subunit -
  B4U56_RS08825 (B4U56_08820) - 1816401..1816886 (-) 486 WP_002502056.1 phage terminase small subunit P27 family -
  B4U56_RS08830 (B4U56_08825) - 1817046..1817396 (-) 351 WP_002502055.1 HNH endonuclease -
  B4U56_RS08835 (B4U56_08830) - 1817879..1818325 (-) 447 WP_002502054.1 transcriptional regulator -
  B4U56_RS12645 - 1818342..1818491 (-) 150 WP_002502053.1 DUF1514 domain-containing protein -
  B4U56_RS08840 (B4U56_08835) rinB 1818492..1818674 (-) 183 WP_002502052.1 transcriptional activator RinB -
  B4U56_RS08845 (B4U56_08840) - 1818779..1819081 (+) 303 WP_002499245.1 DUF4870 domain-containing protein -
  B4U56_RS08850 (B4U56_08845) dut 1819178..1819603 (-) 426 WP_002502051.1 dUTP diphosphatase -
  B4U56_RS12705 - 1819596..1819721 (-) 126 WP_002502050.1 hypothetical protein -
  B4U56_RS08855 (B4U56_08850) - 1819723..1820130 (-) 408 WP_002502049.1 RusA family crossover junction endodeoxyribonuclease -
  B4U56_RS08860 (B4U56_08855) - 1820140..1820367 (-) 228 WP_002502048.1 DUF3269 family protein -
  B4U56_RS08865 (B4U56_08860) - 1820386..1821267 (-) 882 WP_232755969.1 DnaD domain-containing protein -
  B4U56_RS08870 (B4U56_08865) ssbA 1821374..1821841 (-) 468 WP_002502046.1 single-stranded DNA-binding protein Machinery gene
  B4U56_RS08875 (B4U56_08870) - 1821842..1822471 (-) 630 WP_256280252.1 MBL fold metallo-hydrolase -
  B4U56_RS08880 (B4U56_08875) - 1822540..1823475 (-) 936 WP_032606345.1 recombinase RecT -
  B4U56_RS08885 (B4U56_08880) - 1823477..1825426 (-) 1950 WP_002502043.1 AAA family ATPase -
  B4U56_RS08890 (B4U56_08885) - 1825429..1825692 (-) 264 WP_002502042.1 hypothetical protein -
  B4U56_RS08895 (B4U56_08890) - 1825752..1825943 (-) 192 WP_002502041.1 DUF1270 family protein -
  B4U56_RS08900 (B4U56_08895) - 1826033..1826314 (+) 282 WP_002502040.1 hypothetical protein -
  B4U56_RS12505 - 1826311..1826457 (-) 147 WP_002502039.1 hypothetical protein -
  B4U56_RS08905 (B4U56_08900) - 1826473..1826682 (-) 210 WP_002502038.1 hypothetical protein -
  B4U56_RS08910 (B4U56_08905) - 1826740..1827078 (+) 339 WP_002499261.1 hypothetical protein -
  B4U56_RS08915 (B4U56_08910) - 1827064..1827296 (-) 233 Protein_1658 MW1434 family type I TA system toxin -
  B4U56_RS08920 (B4U56_08915) - 1827383..1827595 (+) 213 WP_002499263.1 hypothetical protein -
  B4U56_RS12650 - 1827601..1827687 (-) 87 Protein_1660 hypothetical protein -
  B4U56_RS08925 (B4U56_08920) - 1827729..1828475 (-) 747 WP_002502037.1 phage antirepressor KilAC domain-containing protein -
  B4U56_RS08930 (B4U56_08925) - 1828526..1829080 (+) 555 WP_002502036.1 hypothetical protein -
  B4U56_RS12510 - 1829087..1829224 (-) 138 WP_002502035.1 hypothetical protein -
  B4U56_RS08935 (B4U56_08930) - 1829262..1829501 (-) 240 WP_002499267.1 helix-turn-helix transcriptional regulator -
  B4U56_RS08940 (B4U56_08935) - 1829642..1830262 (+) 621 WP_002499268.1 LexA family protein -
  B4U56_RS12515 - 1830307..1830474 (+) 168 WP_002502034.1 hypothetical protein -
  B4U56_RS08945 (B4U56_08940) - 1830496..1831635 (+) 1140 WP_080280816.1 CapA family protein -
  B4U56_RS08950 (B4U56_08945) - 1831844..1832428 (+) 585 WP_032606347.1 hypothetical protein -
  B4U56_RS08955 (B4U56_08950) - 1832497..1833387 (+) 891 WP_032606348.1 hypothetical protein -
  B4U56_RS08960 (B4U56_08955) - 1833398..1833577 (-) 180 WP_032606349.1 hypothetical protein -
  B4U56_RS08965 (B4U56_08960) - 1833672..1834721 (+) 1050 WP_032606350.1 tyrosine-type recombinase/integrase -
  B4U56_RS08980 (B4U56_08975) comK/comK1 1835122..1835697 (-) 576 WP_001829272.1 competence protein ComK Regulator

Sequence


Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=223405 B4U56_RS08980 WP_001829272.1 1835122..1835697(-) (comK/comK1) [Staphylococcus epidermidis strain 1457]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=223405 B4U56_RS08980 WP_001829272.1 1835122..1835697(-) (comK/comK1) [Staphylococcus epidermidis strain 1457]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains


Predicted by InterproScan.

(7-158)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743

  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743


Multiple sequence alignment