Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   A6J31_RS07905 Genome accession   NZ_CP020431
Coordinates   1549057..1549575 (-) Length   172 a.a.
NCBI ID   WP_002891844.1    Uniprot ID   A0AB33ZBY1
Organism   Streptococcus sp. FDAARGOS_192     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1523849..1590687 1549057..1549575 within 0


Gene organization within MGE regions


Location: 1523849..1590687
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A6J31_RS07780 (A6J31_07715) acpS 1524072..1524425 (-) 354 WP_014635032.1 holo-ACP synthase -
  A6J31_RS07785 (A6J31_07720) - 1524431..1525459 (-) 1029 WP_080610884.1 3-deoxy-7-phosphoheptulonate synthase -
  A6J31_RS07790 (A6J31_07725) - 1525544..1526575 (-) 1032 WP_070437947.1 3-deoxy-7-phosphoheptulonate synthase -
  A6J31_RS07795 (A6J31_07730) secA 1526595..1529144 (-) 2550 WP_070575338.1 preprotein translocase subunit SecA -
  A6J31_RS07800 (A6J31_07735) - 1529327..1529671 (-) 345 WP_014632612.1 hypothetical protein -
  A6J31_RS07805 (A6J31_07740) manA 1529674..1530621 (-) 948 WP_080610886.1 mannose-6-phosphate isomerase, class I -
  A6J31_RS07810 (A6J31_07745) scrK 1530687..1531580 (-) 894 WP_002884717.1 fructokinase ScrK -
  A6J31_RS07815 (A6J31_07750) - 1531761..1533662 (-) 1902 WP_014635038.1 sucrose-specific PTS transporter subunit IIBC -
  A6J31_RS07820 (A6J31_07755) - 1533851..1535293 (+) 1443 WP_105291383.1 sucrose-6-phosphate hydrolase -
  A6J31_RS07825 (A6J31_07760) - 1535302..1536267 (+) 966 WP_013991172.1 LacI family DNA-binding transcriptional regulator -
  A6J31_RS07830 (A6J31_07765) nusB 1536357..1536791 (-) 435 WP_002884506.1 transcription antitermination factor NusB -
  A6J31_RS07835 (A6J31_07770) - 1536784..1537173 (-) 390 WP_002884704.1 Asp23/Gls24 family envelope stress response protein -
  A6J31_RS07840 (A6J31_07775) efp 1537244..1537804 (-) 561 WP_002891830.1 elongation factor P -
  A6J31_RS07845 (A6J31_07780) - 1537920..1538375 (-) 456 WP_002884736.1 deoxycytidylate deaminase -
  A6J31_RS07850 (A6J31_07785) - 1538394..1539455 (-) 1062 WP_013991173.1 M24 family metallopeptidase -
  A6J31_RS07855 (A6J31_07790) - 1539588..1540310 (-) 723 WP_225791566.1 hypothetical protein -
  A6J31_RS11540 - 1540300..1541121 (-) 822 WP_064523077.1 ABC transporter ATP-binding protein -
  A6J31_RS11545 - 1541259..1541411 (-) 153 WP_164555397.1 hypothetical protein -
  A6J31_RS11550 - 1541424..1541573 (-) 150 WP_021152571.1 hypothetical protein -
  A6J31_RS07865 (A6J31_07800) - 1541611..1541745 (-) 135 WP_037599086.1 bacteriocin -
  A6J31_RS07870 (A6J31_07805) - 1541949..1542149 (-) 201 WP_064523080.1 hypothetical protein -
  A6J31_RS11555 - 1542186..1542335 (-) 150 WP_014632605.1 hypothetical protein -
  A6J31_RS07875 (A6J31_07810) - 1542509..1542751 (-) 243 WP_080610888.1 DUF3923 family protein -
  A6J31_RS07880 (A6J31_07815) uvrA 1542846..1545671 (-) 2826 WP_064523086.1 excinuclease ABC subunit UvrA -
  A6J31_RS07885 (A6J31_07820) - 1545967..1546911 (+) 945 WP_064523089.1 magnesium transporter CorA family protein -
  A6J31_RS07890 (A6J31_07825) - 1546981..1547652 (+) 672 WP_014635046.1 DUF1129 domain-containing protein -
  A6J31_RS07895 (A6J31_07830) - 1547769..1548650 (+) 882 WP_080610891.1 DUF4300 family protein -
  A6J31_RS07900 (A6J31_07835) rpsR 1548776..1549015 (-) 240 WP_000068665.1 30S ribosomal protein S18 -
  A6J31_RS07905 (A6J31_07840) ssb 1549057..1549575 (-) 519 WP_002891844.1 single-stranded DNA-binding protein Machinery gene
  A6J31_RS07910 (A6J31_07845) rpsF 1549587..1549877 (-) 291 WP_002884188.1 30S ribosomal protein S6 -
  A6J31_RS07915 (A6J31_07850) - 1550312..1551628 (-) 1317 WP_080610893.1 ISLre2 family transposase -
  A6J31_RS07920 (A6J31_07855) - 1551696..1551884 (-) 189 WP_371596158.1 hypothetical protein -
  A6J31_RS07925 (A6J31_07860) - 1551981..1552772 (-) 792 WP_073949510.1 ParA family protein -
  A6J31_RS07930 (A6J31_07865) - 1553360..1553944 (-) 585 WP_080610894.1 recombinase family protein -
  A6J31_RS07935 (A6J31_07870) - 1554033..1554830 (-) 798 WP_142390726.1 hypothetical protein -
  A6J31_RS07940 (A6J31_07875) - 1554880..1556520 (-) 1641 WP_080610898.1 helical hairpin domain-containing protein -
  A6J31_RS07945 (A6J31_07880) - 1556483..1556857 (-) 375 WP_080610900.1 plasmid mobilization protein -
  A6J31_RS07950 (A6J31_07885) - 1557304..1557606 (-) 303 WP_080610902.1 hypothetical protein -
  A6J31_RS07955 (A6J31_07890) - 1557685..1560918 (-) 3234 WP_080610904.1 PBECR4 domain-containing protein -
  A6J31_RS07960 (A6J31_07895) - 1560934..1562679 (-) 1746 WP_080610906.1 DNA topoisomerase -
  A6J31_RS07965 (A6J31_07900) - 1562846..1563796 (+) 951 WP_080610908.1 hypothetical protein -
  A6J31_RS07970 (A6J31_07905) - 1563782..1564060 (-) 279 WP_080610910.1 hypothetical protein -
  A6J31_RS07975 (A6J31_07910) - 1564072..1565241 (-) 1170 WP_080610912.1 JAB domain-containing protein -
  A6J31_RS11560 - 1565315..1565470 (-) 156 WP_156921844.1 hypothetical protein -
  A6J31_RS07980 (A6J31_07915) - 1565504..1567504 (-) 2001 WP_080610914.1 VirD4-like conjugal transfer protein, CD1115 family -
  A6J31_RS07985 (A6J31_07920) - 1567514..1568038 (-) 525 WP_080610916.1 DUF3801 domain-containing protein -
  A6J31_RS07990 (A6J31_07925) - 1568051..1568959 (-) 909 WP_080610918.1 hypothetical protein -
  A6J31_RS07995 (A6J31_07930) - 1568962..1569231 (-) 270 WP_080610920.1 hypothetical protein -
  A6J31_RS08000 (A6J31_07935) - 1569247..1569765 (-) 519 WP_080610923.1 hypothetical protein -
  A6J31_RS08005 (A6J31_07940) - 1569770..1570453 (-) 684 WP_048788334.1 hypothetical protein -
  A6J31_RS08010 (A6J31_07945) - 1570478..1573252 (-) 2775 WP_080610925.1 phage tail tip lysozyme -
  A6J31_RS08015 (A6J31_07950) - 1573309..1575687 (-) 2379 WP_080611246.1 VirB4-like conjugal transfer ATPase, CD1110 family -
  A6J31_RS08020 (A6J31_07955) - 1575668..1576048 (-) 381 WP_080610927.1 PrgI family protein -
  A6J31_RS08025 (A6J31_07960) - 1576063..1576812 (-) 750 WP_037599298.1 hypothetical protein -
  A6J31_RS08030 (A6J31_07965) - 1576874..1577218 (-) 345 WP_142390727.1 hypothetical protein -
  A6J31_RS08035 (A6J31_07970) - 1577295..1577522 (-) 228 WP_080610932.1 hypothetical protein -
  A6J31_RS08045 (A6J31_07980) - 1578116..1578961 (-) 846 WP_080610938.1 hypothetical protein -
  A6J31_RS08050 (A6J31_07985) - 1578966..1579277 (-) 312 WP_049545419.1 hypothetical protein -
  A6J31_RS08055 (A6J31_07990) - 1579631..1579885 (-) 255 WP_053090567.1 hypothetical protein -
  A6J31_RS08060 (A6J31_07995) - 1579973..1580839 (-) 867 WP_192573925.1 replication initiator protein A -
  A6J31_RS11565 - 1580843..1581004 (-) 162 WP_171963550.1 hypothetical protein -
  A6J31_RS08065 (A6J31_08000) - 1581208..1582161 (+) 954 WP_014635048.1 hypothetical protein -
  A6J31_RS08075 (A6J31_08010) mutY 1583329..1584480 (+) 1152 WP_080610940.1 A/G-specific adenine glycosylase -
  A6J31_RS08080 (A6J31_08015) - 1584775..1585875 (-) 1101 WP_225791568.1 DUF6287 domain-containing protein -
  A6J31_RS08085 (A6J31_08020) polA 1586292..1588931 (-) 2640 WP_080610941.1 DNA polymerase I -

Sequence

Protein


Download         Length: 172 a.a.        Molecular weight: 18594.32 Da        Isoelectric Point: 4.9163

>NTDB_id=222888 A6J31_RS07905 WP_002891844.1 1549057..1549575(-) (ssb) [Streptococcus sp. FDAARGOS_192]
MINNVVLVGRMTRDAELRYTPSNVAVATFSLAVNRNFKGANGERETDFINCVIWRQQAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRAAREGHSGGSYNAGGFDNSNSFGGGASTGGSFGGSQPAQSTPNFGRDESPFGNS
NPMDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=222888 A6J31_RS07905 WP_002891844.1 1549057..1549575(-) (ssb) [Streptococcus sp. FDAARGOS_192]
ATGATTAATAATGTCGTACTCGTTGGTCGCATGACCCGTGATGCGGAACTTCGTTATACACCAAGTAATGTTGCAGTTGC
TACATTCAGTCTTGCAGTTAATCGTAACTTCAAGGGTGCTAATGGTGAACGTGAAACTGACTTTATTAACTGTGTTATCT
GGCGCCAGCAAGCTGAAAATTTGGCTAACTGGGCTAAGAAAGGCGCATTGATTGGAATTACAGGTCGTATTCAGACTCGT
AACTATGAAAATCAACAAGGTCAACGTGTTTACGTAACTGAAGTTGTCGCTGATAATTTCCAAATGTTGGAAAGCCGTGC
GGCACGTGAAGGTCACAGTGGTGGTTCTTACAACGCTGGAGGATTTGATAATTCAAATTCATTCGGTGGAGGAGCTTCAA
CTGGTGGTTCATTTGGTGGATCACAACCTGCACAATCTACACCAAACTTCGGTCGTGATGAGAGTCCATTTGGTAATTCA
AATCCAATGGATATTTCAGATGACGATCTCCCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.046

100

0.587
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.301

100

0.587
  ssb Glaesserella parasuis strain SC1401

32.461

100

0.36

Multiple sequence alignment