Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilI   Type   Machinery gene
Locus tag   A6J46_RS10170 Genome accession   NZ_CP020419
Coordinates   1743879..1744496 (-) Length   205 a.a.
NCBI ID   WP_082298766.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain FDAARGOS_207     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1695234..1756831 1743879..1744496 within 0


Gene organization within MGE regions


Location: 1695234..1756831
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A6J46_RS09850 (A6J46_09935) - 1695234..1695716 (+) 483 Protein_1693 KilA-N domain-containing protein -
  A6J46_RS09855 (A6J46_09940) - 1695962..1696879 (+) 918 WP_082298751.1 Bro-N domain-containing protein -
  A6J46_RS09860 (A6J46_09945) - 1696921..1697472 (-) 552 WP_082298752.1 DUF4760 domain-containing protein -
  A6J46_RS14370 (A6J46_13485) - 1697751..1697882 (+) 132 WP_105211406.1 hypothetical protein -
  A6J46_RS09870 (A6J46_09950) - 1697879..1698247 (+) 369 WP_082298753.1 type II toxin-antitoxin system death-on-curing family toxin -
  A6J46_RS13775 - 1698292..1698441 (-) 150 WP_047949669.1 hypothetical protein -
  A6J46_RS09875 (A6J46_09960) - 1698444..1699118 (-) 675 WP_003693436.1 hypothetical protein -
  A6J46_RS09880 (A6J46_09965) - 1699115..1699600 (-) 486 WP_003693438.1 hypothetical protein -
  A6J46_RS09885 (A6J46_09970) - 1699606..1700079 (-) 474 WP_082298754.1 hypothetical protein -
  A6J46_RS09890 (A6J46_09975) - 1700135..1701430 (-) 1296 WP_003693441.1 DUF4043 family protein -
  A6J46_RS09895 (A6J46_09980) - 1701451..1702011 (-) 561 WP_226876107.1 hypothetical protein -
  A6J46_RS09900 (A6J46_13490) - 1702056..1702367 (-) 312 WP_125460706.1 hypothetical protein -
  A6J46_RS09905 (A6J46_09985) - 1702435..1703628 (-) 1194 WP_082298755.1 hypothetical protein -
  A6J46_RS09910 (A6J46_09990) - 1703616..1706822 (-) 3207 WP_082298756.1 hypothetical protein -
  A6J46_RS09915 (A6J46_09995) - 1706825..1707205 (-) 381 WP_082298757.1 hypothetical protein -
  A6J46_RS09920 (A6J46_10000) - 1707205..1708092 (-) 888 WP_082298758.1 hypothetical protein -
  A6J46_RS09925 (A6J46_10005) - 1708085..1708510 (-) 426 WP_082298759.1 hypothetical protein -
  A6J46_RS09930 (A6J46_10010) - 1708522..1708929 (-) 408 WP_082298808.1 hypothetical protein -
  A6J46_RS09935 (A6J46_10015) - 1709027..1716778 (-) 7752 WP_192941164.1 PLxRFG domain-containing protein -
  A6J46_RS09945 (A6J46_10025) - 1716775..1717971 (-) 1197 WP_082298760.1 hypothetical protein -
  A6J46_RS09950 (A6J46_10030) - 1718210..1720477 (-) 2268 WP_226876108.1 hypothetical protein -
  A6J46_RS09955 (A6J46_10035) - 1720462..1721736 (-) 1275 WP_082298762.1 PBSX family phage terminase large subunit -
  A6J46_RS14150 - 1721717..1722256 (-) 540 WP_226876110.1 hypothetical protein -
  A6J46_RS09970 (A6J46_10050) - 1722256..1722678 (-) 423 WP_003690919.1 hypothetical protein -
  A6J46_RS09975 (A6J46_10055) - 1722743..1723261 (-) 519 WP_003693459.1 HNH endonuclease -
  A6J46_RS09980 (A6J46_10060) - 1723252..1723635 (-) 384 WP_003690918.1 recombination protein NinB -
  A6J46_RS09985 (A6J46_10065) - 1723632..1723937 (-) 306 WP_003687981.1 nuclease domain-containing protein -
  A6J46_RS09990 (A6J46_10070) - 1723930..1724367 (-) 438 WP_226876111.1 RusA family crossover junction endodeoxyribonuclease -
  A6J46_RS14155 - 1724358..1724627 (-) 270 WP_047921130.1 hypothetical protein -
  A6J46_RS09995 (A6J46_10075) - 1724656..1724805 (-) 150 WP_003689110.1 hypothetical protein -
  A6J46_RS10000 (A6J46_10080) - 1724982..1725476 (-) 495 WP_047923539.1 DUF3310 domain-containing protein -
  A6J46_RS10005 (A6J46_10085) - 1725551..1725799 (-) 249 WP_105211409.1 hypothetical protein -
  A6J46_RS10010 (A6J46_10090) - 1725792..1726574 (-) 783 WP_025456432.1 ATP-binding protein -
  A6J46_RS10015 (A6J46_10095) - 1726590..1727624 (-) 1035 WP_082298682.1 helix-turn-helix domain-containing protein -
  A6J46_RS10020 (A6J46_10100) - 1727621..1727848 (-) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  A6J46_RS10025 (A6J46_10105) - 1728022..1728210 (+) 189 WP_003706568.1 hypothetical protein -
  A6J46_RS10030 (A6J46_10110) - 1728187..1728342 (-) 156 WP_047923772.1 hypothetical protein -
  A6J46_RS10035 (A6J46_10115) - 1728422..1728637 (-) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  A6J46_RS10040 (A6J46_10120) - 1728765..1729469 (+) 705 WP_003702453.1 helix-turn-helix transcriptional regulator -
  A6J46_RS10045 (A6J46_10125) - 1729629..1730168 (+) 540 WP_003695998.1 Panacea domain-containing protein -
  A6J46_RS10050 (A6J46_10130) - 1730169..1730528 (+) 360 WP_003691733.1 hypothetical protein -
  A6J46_RS10055 (A6J46_10135) - 1730545..1730763 (-) 219 WP_003691731.1 hypothetical protein -
  A6J46_RS10060 (A6J46_10140) - 1731375..1731707 (+) 333 WP_003696914.1 hypothetical protein -
  A6J46_RS10065 (A6J46_10145) - 1731860..1732135 (+) 276 WP_003695501.1 NGO1622 family putative holin -
  A6J46_RS10070 (A6J46_10150) - 1732132..1732293 (+) 162 WP_004464809.1 hypothetical protein -
  A6J46_RS10075 (A6J46_10155) - 1732362..1733048 (+) 687 WP_010359969.1 phage replication initiation protein, NGO0469 family -
  A6J46_RS10080 (A6J46_10160) - 1733188..1733370 (+) 183 WP_003691535.1 hypothetical protein -
  A6J46_RS10085 (A6J46_10165) - 1733367..1733858 (+) 492 WP_010359966.1 siphovirus Gp157 family protein -
  A6J46_RS14515 - 1734157..1734423 (+) 267 Protein_1741 hypothetical protein -
  A6J46_RS10100 (A6J46_10180) - 1734704..1735387 (+) 684 WP_003687929.1 DUF2786 domain-containing protein -
  A6J46_RS10105 (A6J46_10185) - 1735582..1735851 (+) 270 WP_003687928.1 hypothetical protein -
  A6J46_RS10115 (A6J46_10195) - 1736207..1737403 (-) 1197 WP_105211410.1 integrase arm-type DNA-binding domain-containing protein -
  A6J46_RS10130 (A6J46_10210) yaaA 1737933..1738712 (-) 780 WP_047951699.1 peroxide stress protein YaaA -
  A6J46_RS10135 (A6J46_10215) dapC 1738868..1740055 (-) 1188 WP_082298765.1 succinyldiaminopimelate transaminase -
  A6J46_RS10140 (A6J46_10220) dut 1740133..1740585 (-) 453 WP_047925987.1 dUTP diphosphatase -
  A6J46_RS10145 (A6J46_13495) - 1740751..1741462 (+) 712 Protein_1748 AzlC family ABC transporter permease -
  A6J46_RS10150 (A6J46_10230) - 1741459..1741767 (+) 309 WP_010951048.1 AzlD family protein -
  A6J46_RS10155 (A6J46_10235) pilL 1741837..1742310 (-) 474 WP_025456309.1 PilX family type IV pilin Machinery gene
  A6J46_RS10160 (A6J46_10240) pilK 1742312..1742923 (-) 612 WP_010951047.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  A6J46_RS10165 (A6J46_10245) pilJ 1742902..1743882 (-) 981 WP_105211411.1 PilW family protein Machinery gene
  A6J46_RS10170 (A6J46_10250) pilI 1743879..1744496 (-) 618 WP_082298766.1 type IV pilus modification protein PilV Machinery gene
  A6J46_RS10175 (A6J46_10255) - 1744528..1745190 (-) 663 Protein_1754 GspH/FimT family pseudopilin -
  A6J46_RS10185 (A6J46_10260) dnaB 1745498..1746904 (-) 1407 WP_082298767.1 replicative DNA helicase -
  A6J46_RS10195 (A6J46_10270) - 1747068..1747650 (+) 583 Protein_1756 superoxide dismutase -
  A6J46_RS10205 (A6J46_10280) - 1747880..1748389 (-) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  A6J46_RS10210 (A6J46_10285) - 1748719..1749051 (-) 333 WP_003687908.1 hypothetical protein -
  A6J46_RS10215 (A6J46_10290) cysT 1749232..1750061 (+) 830 Protein_1759 sulfate ABC transporter permease subunit CysT -
  A6J46_RS10220 (A6J46_10295) cysW 1750250..1751110 (+) 861 WP_082298768.1 sulfate ABC transporter permease subunit CysW -
  A6J46_RS10225 (A6J46_10300) - 1751107..1752183 (+) 1077 WP_082298769.1 sulfate/molybdate ABC transporter ATP-binding protein -
  A6J46_RS10230 (A6J46_10305) ilvA 1752239..1753765 (-) 1527 WP_033910484.1 threonine ammonia-lyase, biosynthetic -
  A6J46_RS10235 (A6J46_10310) - 1753914..1755083 (+) 1170 WP_003690889.1 D-alanyl-D-alanine carboxypeptidase family protein -
  A6J46_RS10240 (A6J46_10315) - 1755209..1755781 (-) 573 WP_050164308.1 50S ribosomal protein L25/general stress protein Ctc -
  A6J46_RS10245 (A6J46_10320) - 1755848..1756831 (-) 984 WP_003696879.1 ribose-phosphate pyrophosphokinase -

Sequence


Protein


Download         Length: 205 a.a.        Molecular weight: 22221.08 Da        Isoelectric Point: 4.8132

>NTDB_id=222587 A6J46_RS10170 WP_082298766.1 1743879..1744496(-) (pilI) [Neisseria gonorrhoeae strain FDAARGOS_207]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYTELYTPTPSGGDFKFNNNNLISKKDLAKAQLDRFGYELKQALPDAVAIHHAVCKDSSGDAPTLSDSGDFSSNCDDK
ANGDTLIKVLWVNDSAGDSDISRTNLGVSGGNIVYTYQARVGGRE

Nucleotide


Download         Length: 618 bp        

>NTDB_id=222587 A6J46_RS10170 WP_082298766.1 1743879..1744496(-) (pilI) [Neisseria gonorrhoeae strain FDAARGOS_207]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGGAGCTGTACACCCCCACTCCCTCTGGCGGCGATTTCAAGTTTAATAATAATAATTTGATAAGTAA
GAAGGATTTGGCAAAAGCCCAGTTGGACAGGTTCGGTTATGAATTGAAACAAGCCTTGCCGGATGCGGTAGCTATTCATC
ACGCCGTCTGCAAGGATTCGTCGGGTGACGCGCCGACATTGTCCGACAGCGGTGATTTTTCTTCAAATTGCGACGATAAG
GCAAACGGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGG
GGTGAGCGGCGGCAATATCGTATATACTTATCAGGCAAGGGTCGGAGGTCGTGAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilI Neisseria gonorrhoeae MS11

90.244

100

0.902

  pilV Neisseria gonorrhoeae MS11

90.244

100

0.902

  pilV Neisseria meningitidis 8013

82.609

100

0.834


Multiple sequence alignment