Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C2H96_RS20185 Genome accession   NZ_CP026035
Coordinates   3920497..3920670 (-) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK5_68     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3915497..3925670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H96_RS20140 (C2H96_20085) comGE 3915848..3916195 (+) 348 WP_070547530.1 ComG operon protein 5 Machinery gene
  C2H96_RS20145 (C2H96_20090) comGF 3916221..3916604 (+) 384 WP_070547529.1 ComG operon protein ComGF Machinery gene
  C2H96_RS20150 (C2H96_20095) comGG 3916605..3916979 (+) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2H96_RS20155 (C2H96_20100) spoIIT 3917051..3917230 (+) 180 WP_003230176.1 YqzE family protein -
  C2H96_RS20160 (C2H96_20105) yqzG 3917272..3917598 (-) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H96_RS20165 (C2H96_20110) tapA 3917869..3918630 (+) 762 WP_120028361.1 amyloid fiber anchoring/assembly protein TapA -
  C2H96_RS20170 (C2H96_20115) sipW 3918614..3919186 (+) 573 WP_003246088.1 signal peptidase I SipW -
  C2H96_RS20175 (C2H96_20120) tasA 3919251..3920036 (+) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H96_RS20180 (C2H96_20125) sinR 3920128..3920463 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H96_RS20185 (C2H96_20130) sinI 3920497..3920670 (-) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2H96_RS20190 (C2H96_20140) yqhG 3920854..3921648 (-) 795 WP_032726154.1 YqhG family protein -
  C2H96_RS20195 (C2H96_20145) yqhH 3921669..3923342 (-) 1674 WP_120028360.1 SNF2-related protein -
  C2H96_RS20200 (C2H96_20150) gcvT 3923784..3924872 (+) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=222431 C2H96_RS20185 WP_014477323.1 3920497..3920670(-) (sinI) [Bacillus subtilis strain PK5_68]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=222431 C2H96_RS20185 WP_014477323.1 3920497..3920670(-) (sinI) [Bacillus subtilis strain PK5_68]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982