Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BSK2_RS16035 Genome accession   NZ_CP020367
Coordinates   3107976..3108116 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain GQJK2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3102976..3113116
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSK2_RS16010 (BSK2_16010) yuxO 3103304..3103684 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  BSK2_RS16015 (BSK2_16015) comA 3103703..3104347 (-) 645 WP_080529735.1 two-component system response regulator ComA Regulator
  BSK2_RS16020 (BSK2_16020) comP 3104428..3106689 (-) 2262 WP_080529736.1 histidine kinase Regulator
  BSK2_RS16025 (BSK2_16025) comX 3106705..3106926 (-) 222 WP_014480704.1 competence pheromone ComX -
  BSK2_RS16030 (BSK2_16030) - 3106928..3107791 (-) 864 WP_080529737.1 polyprenyl synthetase family protein -
  BSK2_RS16035 (BSK2_16035) degQ 3107976..3108116 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSK2_RS21155 - 3108338..3108463 (+) 126 WP_003228793.1 hypothetical protein -
  BSK2_RS16040 (BSK2_16040) - 3108578..3108946 (+) 369 WP_014477834.1 hypothetical protein -
  BSK2_RS16045 (BSK2_16045) pdeH 3108922..3110151 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BSK2_RS16050 (BSK2_16050) pncB 3110288..3111760 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BSK2_RS16055 (BSK2_16055) pncA 3111776..3112327 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  BSK2_RS16060 (BSK2_16060) yueI 3112424..3112822 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=221781 BSK2_RS16035 WP_003220708.1 3107976..3108116(-) (degQ) [Bacillus subtilis strain GQJK2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=221781 BSK2_RS16035 WP_003220708.1 3107976..3108116(-) (degQ) [Bacillus subtilis strain GQJK2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment