Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BSK2_RS12400 Genome accession   NZ_CP020367
Coordinates   2433450..2433833 (-) Length   127 a.a.
NCBI ID   WP_080529536.1    Uniprot ID   -
Organism   Bacillus subtilis strain GQJK2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2428450..2438833
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSK2_RS12360 (BSK2_12360) sinI 2429384..2429557 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSK2_RS12365 (BSK2_12365) sinR 2429591..2429926 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSK2_RS12370 (BSK2_12370) tasA 2430019..2430804 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  BSK2_RS12375 (BSK2_12375) sipW 2430868..2431440 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BSK2_RS12380 (BSK2_12380) tapA 2431424..2432185 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  BSK2_RS12385 (BSK2_12385) yqzG 2432457..2432783 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  BSK2_RS12390 (BSK2_12390) spoIITA 2432825..2433004 (-) 180 WP_014480252.1 YqzE family protein -
  BSK2_RS12395 (BSK2_12395) comGG 2433075..2433449 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSK2_RS12400 (BSK2_12400) comGF 2433450..2433833 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  BSK2_RS12405 (BSK2_12405) comGE 2433859..2434206 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  BSK2_RS12410 (BSK2_12410) comGD 2434190..2434621 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  BSK2_RS12415 (BSK2_12415) comGC 2434611..2434907 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BSK2_RS12420 (BSK2_12420) comGB 2434921..2435958 (-) 1038 WP_080529539.1 comG operon protein ComGB Machinery gene
  BSK2_RS12425 (BSK2_12425) comGA 2435945..2437015 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BSK2_RS12430 (BSK2_12430) - 2437228..2437425 (-) 198 WP_080529540.1 hypothetical protein -
  BSK2_RS12435 (BSK2_12435) corA 2437427..2438380 (-) 954 WP_080529541.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14414.53 Da        Isoelectric Point: 6.2135

>NTDB_id=221760 BSK2_RS12400 WP_080529536.1 2433450..2433833(-) (comGF) [Bacillus subtilis strain GQJK2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=221760 BSK2_RS12400 WP_080529536.1 2433450..2433833(-) (comGF) [Bacillus subtilis strain GQJK2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.206

99.213

0.984


Multiple sequence alignment