Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSK2_RS12360 Genome accession   NZ_CP020367
Coordinates   2429384..2429557 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain GQJK2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2424384..2434557
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSK2_RS12345 (BSK2_12345) gcvT 2425184..2426272 (-) 1089 WP_080529534.1 glycine cleavage system aminomethyltransferase GcvT -
  BSK2_RS12350 (BSK2_12350) hepAA 2426713..2428386 (+) 1674 WP_080529535.1 SNF2-related protein -
  BSK2_RS12355 (BSK2_12355) yqhG 2428407..2429201 (+) 795 WP_003230200.1 YqhG family protein -
  BSK2_RS12360 (BSK2_12360) sinI 2429384..2429557 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSK2_RS12365 (BSK2_12365) sinR 2429591..2429926 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSK2_RS12370 (BSK2_12370) tasA 2430019..2430804 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  BSK2_RS12375 (BSK2_12375) sipW 2430868..2431440 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BSK2_RS12380 (BSK2_12380) tapA 2431424..2432185 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  BSK2_RS12385 (BSK2_12385) yqzG 2432457..2432783 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  BSK2_RS12390 (BSK2_12390) spoIITA 2432825..2433004 (-) 180 WP_014480252.1 YqzE family protein -
  BSK2_RS12395 (BSK2_12395) comGG 2433075..2433449 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSK2_RS12400 (BSK2_12400) comGF 2433450..2433833 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  BSK2_RS12405 (BSK2_12405) comGE 2433859..2434206 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=221757 BSK2_RS12360 WP_003230187.1 2429384..2429557(+) (sinI) [Bacillus subtilis strain GQJK2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=221757 BSK2_RS12360 WP_003230187.1 2429384..2429557(+) (sinI) [Bacillus subtilis strain GQJK2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment