Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BS21228_RS03035 Genome accession   NZ_CP020023
Coordinates   530949..531323 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain ATCC 21228     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 525949..536323
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS21228_RS02995 (BS21228_02960) yqhG 526281..527075 (+) 795 WP_014480249.1 YqhG family protein -
  BS21228_RS03000 (BS21228_02965) sinI 527258..527431 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BS21228_RS03005 (BS21228_02970) sinR 527465..527800 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BS21228_RS03010 (BS21228_02975) tasA 527893..528678 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BS21228_RS03015 (BS21228_02980) sipW 528742..529314 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BS21228_RS03020 (BS21228_02985) tapA 529298..530059 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BS21228_RS03025 (BS21228_02990) yqzG 530331..530657 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BS21228_RS03030 (BS21228_02995) spoIITA 530699..530878 (-) 180 WP_014480252.1 YqzE family protein -
  BS21228_RS03035 (BS21228_03000) comGG 530949..531323 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BS21228_RS03040 (BS21228_03005) comGF 531324..531707 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BS21228_RS03045 (BS21228_03010) comGE 531733..532080 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BS21228_RS03050 (BS21228_03015) comGD 532064..532495 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  BS21228_RS03055 (BS21228_03020) comGC 532485..532781 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BS21228_RS03060 (BS21228_03025) comGB 532795..533832 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  BS21228_RS03065 (BS21228_03030) comGA 533819..534889 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BS21228_RS03070 (BS21228_03035) - 535101..535298 (-) 198 WP_014480259.1 CBS domain-containing protein -
  BS21228_RS03075 (BS21228_03040) corA 535300..536253 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=220304 BS21228_RS03035 WP_014480253.1 530949..531323(-) (comGG) [Bacillus subtilis strain ATCC 21228]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=220304 BS21228_RS03035 WP_014480253.1 530949..531323(-) (comGG) [Bacillus subtilis strain ATCC 21228]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment