Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BS21228_RS03000 Genome accession   NZ_CP020023
Coordinates   527258..527431 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ATCC 21228     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 522258..532431
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS21228_RS02985 (BS21228_02950) gcvT 523057..524145 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  BS21228_RS02990 (BS21228_02955) hepAA 524587..526260 (+) 1674 WP_014480248.1 SNF2-related protein -
  BS21228_RS02995 (BS21228_02960) yqhG 526281..527075 (+) 795 WP_014480249.1 YqhG family protein -
  BS21228_RS03000 (BS21228_02965) sinI 527258..527431 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BS21228_RS03005 (BS21228_02970) sinR 527465..527800 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BS21228_RS03010 (BS21228_02975) tasA 527893..528678 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BS21228_RS03015 (BS21228_02980) sipW 528742..529314 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BS21228_RS03020 (BS21228_02985) tapA 529298..530059 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BS21228_RS03025 (BS21228_02990) yqzG 530331..530657 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BS21228_RS03030 (BS21228_02995) spoIITA 530699..530878 (-) 180 WP_014480252.1 YqzE family protein -
  BS21228_RS03035 (BS21228_03000) comGG 530949..531323 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BS21228_RS03040 (BS21228_03005) comGF 531324..531707 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BS21228_RS03045 (BS21228_03010) comGE 531733..532080 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=220302 BS21228_RS03000 WP_003230187.1 527258..527431(+) (sinI) [Bacillus subtilis strain ATCC 21228]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=220302 BS21228_RS03000 WP_003230187.1 527258..527431(+) (sinI) [Bacillus subtilis strain ATCC 21228]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment