Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BZ167_RS17560 Genome accession   NZ_CP019626
Coordinates   3547217..3547390 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus sp. 275     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3542217..3552390
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BZ167_RS17510 (BZ167_17585) comGD 3542337..3542774 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  BZ167_RS17515 (BZ167_17590) comGE 3542758..3543072 (+) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  BZ167_RS17520 (BZ167_17595) comGF 3542981..3543481 (+) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  BZ167_RS17525 (BZ167_17600) comGG 3543482..3543859 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BZ167_RS17530 (BZ167_17605) - 3543916..3544095 (+) 180 WP_003153093.1 YqzE family protein -
  BZ167_RS17535 (BZ167_17610) - 3544135..3544464 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BZ167_RS17540 (BZ167_17615) tapA 3544723..3545394 (+) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  BZ167_RS17545 (BZ167_17620) - 3545366..3545950 (+) 585 WP_015240205.1 signal peptidase I -
  BZ167_RS17550 (BZ167_17625) - 3546015..3546800 (+) 786 WP_007408329.1 TasA family protein -
  BZ167_RS17555 (BZ167_17630) sinR 3546848..3547183 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BZ167_RS17560 (BZ167_17635) sinI 3547217..3547390 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  BZ167_RS17565 (BZ167_17640) - 3547567..3548361 (-) 795 WP_007408330.1 YqhG family protein -
  BZ167_RS17570 (BZ167_17645) - 3548383..3550053 (-) 1671 WP_015417810.1 SNF2-related protein -
  BZ167_RS17575 (BZ167_17650) gcvT 3550477..3551577 (+) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=217389 BZ167_RS17560 WP_003153105.1 3547217..3547390(-) (sinI) [Bacillus sp. 275]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=217389 BZ167_RS17560 WP_003153105.1 3547217..3547390(-) (sinI) [Bacillus sp. 275]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment