Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   BZ167_RS17505 Genome accession   NZ_CP019626
Coordinates   3542081..3542347 (+) Length   88 a.a.
NCBI ID   WP_050515801.1    Uniprot ID   -
Organism   Bacillus sp. 275     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3537081..3547347
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BZ167_RS17485 (BZ167_17560) - 3537350..3538651 (-) 1302 WP_012117986.1 hemolysin family protein -
  BZ167_RS17490 (BZ167_17565) - 3538797..3539747 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  BZ167_RS17495 (BZ167_17570) comGA 3539940..3541010 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BZ167_RS17500 (BZ167_17575) comGB 3540997..3542034 (+) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  BZ167_RS17505 (BZ167_17580) comGC 3542081..3542347 (+) 267 WP_050515801.1 competence type IV pilus major pilin ComGC Machinery gene
  BZ167_RS17510 (BZ167_17585) comGD 3542337..3542774 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  BZ167_RS17515 (BZ167_17590) comGE 3542758..3543072 (+) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  BZ167_RS17520 (BZ167_17595) comGF 3542981..3543481 (+) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  BZ167_RS17525 (BZ167_17600) comGG 3543482..3543859 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BZ167_RS17530 (BZ167_17605) - 3543916..3544095 (+) 180 WP_003153093.1 YqzE family protein -
  BZ167_RS17535 (BZ167_17610) - 3544135..3544464 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BZ167_RS17540 (BZ167_17615) tapA 3544723..3545394 (+) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  BZ167_RS17545 (BZ167_17620) - 3545366..3545950 (+) 585 WP_015240205.1 signal peptidase I -
  BZ167_RS17550 (BZ167_17625) - 3546015..3546800 (+) 786 WP_007408329.1 TasA family protein -
  BZ167_RS17555 (BZ167_17630) sinR 3546848..3547183 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9749.37 Da        Isoelectric Point: 6.2027

>NTDB_id=217385 BZ167_RS17505 WP_050515801.1 3542081..3542347(+) (comGC) [Bacillus sp. 275]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTVCPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=217385 BZ167_RS17505 WP_050515801.1 3542081..3542347(+) (comGC) [Bacillus sp. 275]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGTCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

76.056

80.682

0.614


Multiple sequence alignment