Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   BZG32_RS13785 Genome accession   NZ_CP019512
Coordinates   2626530..2627057 (-) Length   175 a.a.
NCBI ID   WP_010708003.1    Uniprot ID   -
Organism   Enterococcus faecalis strain CLB21560     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2589761..2636448 2626530..2627057 within 0


Gene organization within MGE regions


Location: 2589761..2636448
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BZG32_RS13510 (BZG32_13515) - 2589761..2590303 (-) 543 WP_002404589.1 5-formyltetrahydrofolate cyclo-ligase -
  BZG32_RS13515 (BZG32_13520) - 2590391..2591161 (-) 771 WP_002356329.1 alpha/beta fold hydrolase -
  BZG32_RS13525 (BZG32_13530) - 2591327..2591902 (+) 576 WP_002356327.1 DUF805 domain-containing protein -
  BZG32_RS13530 (BZG32_13535) - 2591993..2593558 (+) 1566 WP_002404588.1 membrane protein -
  BZG32_RS17990 (BZG32_13540) - 2593912..2594643 (+) 732 WP_411158702.1 DUF4950 domain-containing protein -
  BZG32_RS13540 (BZG32_13545) - 2594903..2595967 (-) 1065 WP_002359404.1 FUSC family protein -
  BZG32_RS13545 (BZG32_13550) - 2596223..2596474 (-) 252 WP_002382470.1 hypothetical protein -
  BZG32_RS13555 (BZG32_13560) - 2596975..2597424 (-) 450 WP_002404586.1 protein-export chaperone SecB -
  BZG32_RS13560 (BZG32_13565) - 2597424..2597798 (-) 375 WP_002404585.1 hypothetical protein -
  BZG32_RS13565 (BZG32_13570) - 2597801..2598325 (-) 525 WP_010708026.1 hypothetical protein -
  BZG32_RS13575 (BZG32_13580) - 2599075..2600313 (-) 1239 WP_002404583.1 LysM peptidoglycan-binding domain-containing protein -
  BZG32_RS13580 (BZG32_13585) - 2600314..2600547 (-) 234 WP_002404582.1 phage holin -
  BZG32_RS13585 (BZG32_13590) - 2600540..2600761 (-) 222 WP_002374005.1 hypothetical protein -
  BZG32_RS13590 (BZG32_13595) - 2600795..2600932 (-) 138 WP_002404581.1 XkdX family protein -
  BZG32_RS13595 (BZG32_13600) - 2600932..2601306 (-) 375 WP_002404580.1 hypothetical protein -
  BZG32_RS13600 (BZG32_13605) - 2601325..2601852 (-) 528 WP_002404579.1 hypothetical protein -
  BZG32_RS13605 (BZG32_13610) - 2601852..2602139 (-) 288 WP_002404578.1 collagen-like protein -
  BZG32_RS13610 (BZG32_13615) - 2602136..2602732 (-) 597 WP_002404577.1 hypothetical protein -
  BZG32_RS13615 (BZG32_13620) - 2602725..2603606 (-) 882 WP_002404576.1 phage baseplate upper protein -
  BZG32_RS13620 (BZG32_13625) - 2603625..2606432 (-) 2808 WP_002384367.1 phage tail spike protein -
  BZG32_RS13625 (BZG32_13630) - 2606414..2607148 (-) 735 WP_002403868.1 tail protein -
  BZG32_RS13630 (BZG32_13635) - 2607138..2610056 (-) 2919 WP_002404575.1 tape measure protein -
  BZG32_RS13635 (BZG32_13640) gpG 2610304..2610654 (-) 351 WP_002357039.1 phage tail assembly chaperone G -
  BZG32_RS13640 (BZG32_13645) - 2610707..2611555 (-) 849 WP_002384363.1 major tail protein -
  BZG32_RS13645 (BZG32_13650) - 2611556..2611930 (-) 375 WP_010708022.1 DUF6838 family protein -
  BZG32_RS13650 (BZG32_13655) - 2611934..2612332 (-) 399 WP_010708021.1 HK97 gp10 family phage protein -
  BZG32_RS13655 (BZG32_13660) - 2612325..2612693 (-) 369 WP_010708020.1 hypothetical protein -
  BZG32_RS13660 (BZG32_13665) - 2612690..2613034 (-) 345 WP_010708019.1 hypothetical protein -
  BZG32_RS13665 (BZG32_13670) - 2613048..2613230 (-) 183 WP_002387281.1 hypothetical protein -
  BZG32_RS13670 (BZG32_13675) - 2613259..2614146 (-) 888 WP_002357030.1 DUF5309 domain-containing protein -
  BZG32_RS13675 (BZG32_13680) - 2614160..2614783 (-) 624 WP_077143734.1 DUF4355 domain-containing protein -
  BZG32_RS13685 (BZG32_13690) - 2615118..2615438 (-) 321 WP_010708017.1 hypothetical protein -
  BZG32_RS13690 (BZG32_13695) - 2615497..2615742 (-) 246 WP_002397460.1 hypothetical protein -
  BZG32_RS17365 - 2615747..2617441 (-) 1695 WP_010708016.1 toxin glutamine deamidase domain-containing protein -
  BZG32_RS13705 (BZG32_13710) - 2617419..2618903 (-) 1485 WP_010708015.1 phage portal protein -
  BZG32_RS13710 (BZG32_13715) - 2618915..2620204 (-) 1290 WP_029656821.1 PBSX family phage terminase large subunit -
  BZG32_RS13715 (BZG32_13720) terS 2620176..2620970 (-) 795 WP_010708013.1 phage terminase small subunit -
  BZG32_RS13720 (BZG32_13725) - 2621023..2621247 (-) 225 WP_010708012.1 hypothetical protein -
  BZG32_RS13730 (BZG32_13735) - 2622358..2622774 (-) 417 WP_002357362.1 ArpU family phage packaging/lysis transcriptional regulator -
  BZG32_RS13740 (BZG32_13745) - 2623164..2623367 (-) 204 WP_010708011.1 hypothetical protein -
  BZG32_RS17555 - 2623367..2623528 (-) 162 WP_016024519.1 hypothetical protein -
  BZG32_RS13745 (BZG32_13750) - 2623529..2624095 (-) 567 WP_010708010.1 DUF1642 domain-containing protein -
  BZG32_RS13750 (BZG32_13755) - 2624088..2624348 (-) 261 WP_002365172.1 hypothetical protein -
  BZG32_RS13755 (BZG32_13760) - 2624372..2624731 (-) 360 WP_010708009.1 hypothetical protein -
  BZG32_RS13760 (BZG32_13765) - 2624731..2625102 (-) 372 WP_010708008.1 YopX family protein -
  BZG32_RS13765 (BZG32_13770) - 2625123..2625443 (-) 321 WP_010708007.1 hypothetical protein -
  BZG32_RS13770 (BZG32_13775) - 2625445..2625909 (-) 465 WP_025191277.1 class I SAM-dependent methyltransferase -
  BZG32_RS13775 (BZG32_13780) - 2625963..2626169 (-) 207 WP_025191638.1 hypothetical protein -
  BZG32_RS13780 (BZG32_13785) - 2626189..2626518 (-) 330 WP_010708004.1 hypothetical protein -
  BZG32_RS13785 (BZG32_13790) ssb 2626530..2627057 (-) 528 WP_010708003.1 single-stranded DNA-binding protein Machinery gene
  BZG32_RS13790 (BZG32_13795) - 2627062..2627913 (-) 852 WP_010708002.1 helix-turn-helix domain-containing protein -
  BZG32_RS13795 (BZG32_13800) - 2627917..2628558 (-) 642 WP_002414632.1 putative HNHc nuclease -
  BZG32_RS13800 (BZG32_13805) - 2628563..2629579 (-) 1017 WP_002365157.1 AAA family ATPase -
  BZG32_RS13805 (BZG32_13810) - 2629591..2630070 (-) 480 WP_010708001.1 siphovirus Gp157 family protein -
  BZG32_RS17825 - 2630054..2630176 (-) 123 WP_002414628.1 hypothetical protein -
  BZG32_RS13815 (BZG32_13820) - 2630375..2630548 (-) 174 WP_002395693.1 hypothetical protein -
  BZG32_RS13820 (BZG32_13825) - 2630560..2630745 (-) 186 WP_077143735.1 hypothetical protein -
  BZG32_RS13830 (BZG32_13835) - 2630929..2631318 (+) 390 WP_010707997.1 DUF2513 domain-containing protein -
  BZG32_RS17370 - 2631290..2631442 (-) 153 WP_010707996.1 hypothetical protein -
  BZG32_RS13835 (BZG32_13840) - 2631453..2632163 (-) 711 WP_010707995.1 Rha family transcriptional regulator -
  BZG32_RS13840 (BZG32_13845) - 2632241..2632690 (+) 450 WP_002404538.1 hypothetical protein -
  BZG32_RS17375 - 2632837..2632977 (-) 141 WP_002404537.1 hypothetical protein -
  BZG32_RS13845 (BZG32_13850) - 2633016..2633285 (-) 270 WP_002404536.1 hypothetical protein -
  BZG32_RS13850 (BZG32_13855) - 2633298..2633480 (-) 183 WP_002404535.1 hypothetical protein -
  BZG32_RS13855 (BZG32_13860) - 2633776..2634096 (+) 321 WP_002404534.1 helix-turn-helix domain-containing protein -
  BZG32_RS13860 (BZG32_13865) - 2634114..2634536 (+) 423 WP_002404533.1 ImmA/IrrE family metallo-endopeptidase -
  BZG32_RS13865 (BZG32_13870) - 2634624..2635142 (+) 519 WP_002404532.1 hypothetical protein -
  BZG32_RS13870 (BZG32_13875) - 2635267..2636448 (+) 1182 WP_002404531.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19373.26 Da        Isoelectric Point: 4.7078

>NTDB_id=216143 BZG32_RS13785 WP_010708003.1 2626530..2627057(-) (ssb) [Enterococcus faecalis strain CLB21560]
MINQVVLVGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVICESFQLLESKSTNENRNSIQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=216143 BZG32_RS13785 WP_010708003.1 2626530..2627057(-) (ssb) [Enterococcus faecalis strain CLB21560]
ATGATAAACCAAGTTGTGTTAGTTGGACGTTTAACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTATTTGCGAGAGTTTCCAATTATTAGAGTCAAAAAG
CACCAACGAGAATAGAAATAGCATTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTTGAGAGTAATTATG
CCACAAATCAAAATAAAGGCTTAAATCAACAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGCGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.551

100

0.606
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.427

100

0.594
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

60.571

0.36

Multiple sequence alignment