Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   BTR42_RS07055 Genome accession   NZ_CP018822
Coordinates   1396002..1396442 (-) Length   146 a.a.
NCBI ID   WP_012962070.1    Uniprot ID   A0A139MWJ9
Organism   Streptococcus gallolyticus subsp. gallolyticus DSM 16831     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1390734..1412704 1396002..1396442 within 0


Gene organization within MGE regions


Location: 1390734..1412704
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BTR42_RS07035 (BTR42_06730) - 1390734..1391186 (-) 453 WP_009854390.1 MarR family winged helix-turn-helix transcriptional regulator -
  BTR42_RS07040 (BTR42_06735) - 1391176..1392153 (-) 978 WP_009854391.1 zinc-binding dehydrogenase -
  BTR42_RS07045 (BTR42_06740) rcrQ 1392422..1394194 (-) 1773 WP_009854392.1 ABC transporter ATP-binding protein Regulator
  BTR42_RS07050 (BTR42_06745) rcrP 1394184..1395998 (-) 1815 WP_009854393.1 ABC transporter ATP-binding protein Regulator
  BTR42_RS07055 (BTR42_06750) rcrR 1396002..1396442 (-) 441 WP_012962070.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  BTR42_RS07060 (BTR42_06755) - 1396617..1397027 (-) 411 WP_009854395.1 peptide deformylase -
  BTR42_RS07065 (BTR42_06760) - 1397024..1397533 (-) 510 WP_077496988.1 GNAT family N-acetyltransferase -
  BTR42_RS07070 (BTR42_06765) gdhA 1397800..1399149 (-) 1350 WP_009854398.1 NADP-specific glutamate dehydrogenase -
  BTR42_RS07075 (BTR42_06770) - 1399396..1399893 (+) 498 WP_009854399.1 DUF308 domain-containing protein -
  BTR42_RS12750 (BTR42_06775) queF 1399950..1400441 (-) 492 WP_009854400.1 preQ(1) synthase -
  BTR42_RS12755 (BTR42_06780) queE 1400454..1401167 (-) 714 WP_009854401.1 7-carboxy-7-deazaguanine synthase QueE -
  BTR42_RS07085 (BTR42_06785) queD 1401160..1401606 (-) 447 WP_009854402.1 6-carboxytetrahydropterin synthase QueD -
  BTR42_RS07090 (BTR42_06790) queC 1401612..1402259 (-) 648 WP_043878574.1 7-cyano-7-deazaguanine synthase QueC -
  BTR42_RS07095 (BTR42_06795) - 1402500..1404269 (-) 1770 WP_009854404.1 ABC transporter ATP-binding protein -
  BTR42_RS07100 (BTR42_06800) - 1404272..1406011 (-) 1740 WP_043878575.1 ABC transporter ATP-binding protein -
  BTR42_RS07105 (BTR42_06805) - 1406089..1407960 (-) 1872 WP_009854406.1 ABC-F family ATP-binding cassette domain-containing protein -
  BTR42_RS07110 (BTR42_06810) - 1407957..1409162 (-) 1206 WP_009854407.1 CCA tRNA nucleotidyltransferase -
  BTR42_RS07115 (BTR42_06815) dapB 1409159..1409926 (-) 768 WP_009854408.1 4-hydroxy-tetrahydrodipicolinate reductase -
  BTR42_RS07120 (BTR42_06820) - 1409946..1410794 (-) 849 WP_009854409.1 DegV family protein -
  BTR42_RS07125 (BTR42_06825) - 1410794..1411174 (-) 381 WP_009854410.1 DUF1149 family protein -
  BTR42_RS07130 (BTR42_06830) - 1411303..1412076 (-) 774 WP_009854411.1 TMEM175 family protein -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 17156.66 Da        Isoelectric Point: 9.3565

>NTDB_id=210639 BTR42_RS07055 WP_012962070.1 1396002..1396442(-) (rcrR) [Streptococcus gallolyticus subsp. gallolyticus DSM 16831]
MHKKDPFSQFRDFINLMENRVHALAESHGVENLAGPQGFAVMYLRDNPDKEIYIKDIEKRLRISKSVTSNLIKRMEKNGF
IQVVSSKEDKRYKQVVLTELGKSKAQDIQDFHDEMHRQILAGVDHEDLKISFRVFDRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=210639 BTR42_RS07055 WP_012962070.1 1396002..1396442(-) (rcrR) [Streptococcus gallolyticus subsp. gallolyticus DSM 16831]
ATGCACAAGAAAGATCCGTTTTCACAGTTTAGGGATTTTATCAATTTAATGGAAAATCGTGTCCACGCTCTTGCGGAAAG
TCATGGTGTTGAAAATCTAGCTGGTCCACAGGGATTTGCAGTGATGTATCTTCGTGATAATCCCGATAAAGAAATTTATA
TTAAGGACATTGAGAAGAGACTAAGAATTTCAAAGTCAGTGACTAGTAATTTGATTAAGCGCATGGAGAAAAATGGTTTT
ATCCAAGTTGTTTCGTCAAAAGAAGATAAGCGTTATAAGCAAGTTGTGTTGACTGAGCTTGGAAAATCAAAGGCTCAGGA
TATTCAAGATTTCCATGATGAAATGCATAGGCAAATCTTAGCTGGTGTTGACCATGAGGATCTCAAAATCTCGTTTCGCG
TCTTTGACCGCATTTTGAAAAATTTAGAAAACAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(35-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A139MWJ9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

56.643

97.945

0.555

Multiple sequence alignment