Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BSO20_RS00275 Genome accession   NZ_CP018200
Coordinates   41032..41205 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain WS-8     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 36032..46205
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSO20_RS00225 (BSO20_00225) comGD 36151..36588 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BSO20_RS00230 (BSO20_00230) comGE 36572..36886 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  BSO20_RS00235 (BSO20_00235) comGF 36795..37295 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  BSO20_RS00240 (BSO20_00240) comGG 37296..37673 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  BSO20_RS00245 (BSO20_00245) - 37730..37909 (+) 180 WP_022552966.1 YqzE family protein -
  BSO20_RS00250 (BSO20_00250) - 37950..38279 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  BSO20_RS00255 (BSO20_00255) tapA 38538..39209 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  BSO20_RS00260 (BSO20_00260) sipW 39181..39765 (+) 585 WP_032874025.1 signal peptidase I SipW -
  BSO20_RS00265 (BSO20_00265) tasA 39830..40615 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  BSO20_RS00270 (BSO20_00270) sinR 40663..40998 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BSO20_RS00275 (BSO20_00275) sinI 41032..41205 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  BSO20_RS00280 (BSO20_00280) - 41382..42176 (-) 795 WP_007612541.1 YqhG family protein -
  BSO20_RS00285 (BSO20_00285) - 42198..43868 (-) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  BSO20_RS00290 (BSO20_00290) gcvT 44291..45391 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=207101 BSO20_RS00275 WP_032874029.1 41032..41205(-) (sinI) [Bacillus amyloliquefaciens strain WS-8]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=207101 BSO20_RS00275 WP_032874029.1 41032..41205(-) (sinI) [Bacillus amyloliquefaciens strain WS-8]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment