Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSL056_RS16005 Genome accession   NZ_CP018197
Coordinates   3081251..3081391 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain KCTC 12796BP     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3076251..3086391
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSL056_RS15980 (BSL056_16005) - 3076517..3076906 (-) 390 WP_044332441.1 hotdog fold thioesterase -
  BSL056_RS15985 (BSL056_16010) comA 3076930..3077571 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  BSL056_RS15990 (BSL056_16015) comP 3077652..3079964 (-) 2313 WP_073207243.1 ATP-binding protein Regulator
  BSL056_RS15995 (BSL056_16020) comX 3080018..3080188 (-) 171 WP_073207246.1 competence pheromone ComX -
  BSL056_RS16000 (BSL056_16025) - 3080185..3081099 (-) 915 WP_024423324.1 polyprenyl synthetase family protein -
  BSL056_RS16005 (BSL056_16030) degQ 3081251..3081391 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BSL056_RS16010 (BSL056_16035) - 3081897..3082253 (+) 357 WP_052503035.1 hypothetical protein -
  BSL056_RS16015 (BSL056_16040) - 3082289..3083515 (-) 1227 WP_073207248.1 HDOD domain-containing protein -
  BSL056_RS16020 (BSL056_16045) - 3083653..3085125 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  BSL056_RS16025 (BSL056_16050) - 3085143..3085694 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  BSL056_RS16030 (BSL056_16055) - 3085755..3086162 (-) 408 WP_024423329.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=207048 BSL056_RS16005 WP_003213123.1 3081251..3081391(-) (degQ) [Bacillus safensis strain KCTC 12796BP]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=207048 BSL056_RS16005 WP_003213123.1 3081251..3081391(-) (degQ) [Bacillus safensis strain KCTC 12796BP]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment