Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSR08_RS08920 Genome accession   NZ_CP018184
Coordinates   1631901..1632074 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain KH2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1626901..1637074
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSR08_RS08905 (BSR08_09040) gcvT 1627700..1628788 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  BSR08_RS08910 (BSR08_09045) hepAA 1629230..1630903 (+) 1674 WP_014480248.1 SNF2-related protein -
  BSR08_RS08915 (BSR08_09050) yqhG 1630924..1631718 (+) 795 WP_014480249.1 YqhG family protein -
  BSR08_RS08920 (BSR08_09055) sinI 1631901..1632074 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSR08_RS08925 (BSR08_09060) sinR 1632108..1632443 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSR08_RS08930 (BSR08_09065) tasA 1632536..1633321 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BSR08_RS08935 (BSR08_09070) sipW 1633385..1633957 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BSR08_RS08940 (BSR08_09075) tapA 1633941..1634702 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BSR08_RS08945 (BSR08_09080) yqzG 1634974..1635300 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSR08_RS08950 (BSR08_09085) spoIITA 1635342..1635521 (-) 180 WP_014480252.1 YqzE family protein -
  BSR08_RS08955 (BSR08_09090) comGG 1635592..1635966 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSR08_RS08960 (BSR08_09095) comGF 1635967..1636350 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BSR08_RS08965 (BSR08_09100) comGE 1636376..1636723 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=206697 BSR08_RS08920 WP_003230187.1 1631901..1632074(+) (sinI) [Bacillus subtilis strain KH2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=206697 BSR08_RS08920 WP_003230187.1 1631901..1632074(+) (sinI) [Bacillus subtilis strain KH2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment