Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BSR08_RS08960 Genome accession   NZ_CP018184
Coordinates   1635967..1636350 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain KH2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1630967..1641350
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSR08_RS08920 (BSR08_09055) sinI 1631901..1632074 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSR08_RS08925 (BSR08_09060) sinR 1632108..1632443 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSR08_RS08930 (BSR08_09065) tasA 1632536..1633321 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BSR08_RS08935 (BSR08_09070) sipW 1633385..1633957 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BSR08_RS08940 (BSR08_09075) tapA 1633941..1634702 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BSR08_RS08945 (BSR08_09080) yqzG 1634974..1635300 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSR08_RS08950 (BSR08_09085) spoIITA 1635342..1635521 (-) 180 WP_014480252.1 YqzE family protein -
  BSR08_RS08955 (BSR08_09090) comGG 1635592..1635966 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSR08_RS08960 (BSR08_09095) comGF 1635967..1636350 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BSR08_RS08965 (BSR08_09100) comGE 1636376..1636723 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BSR08_RS08970 (BSR08_09105) comGD 1636707..1637138 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  BSR08_RS08975 (BSR08_09110) comGC 1637128..1637424 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BSR08_RS08980 (BSR08_09115) comGB 1637438..1638475 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  BSR08_RS08985 (BSR08_09120) comGA 1638462..1639532 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BSR08_RS08990 (BSR08_09130) - 1639744..1639941 (-) 198 WP_014480259.1 CBS domain-containing protein -
  BSR08_RS08995 (BSR08_09135) corA 1639943..1640896 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=206700 BSR08_RS08960 WP_014480254.1 1635967..1636350(-) (comGF) [Bacillus subtilis strain KH2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=206700 BSR08_RS08960 WP_014480254.1 1635967..1636350(-) (comGF) [Bacillus subtilis strain KH2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment