Detailed information    

insolico Bioinformatically predicted

Overview

Name   ccpA   Type   Regulator
Locus tag   BMF34_RS06840 Genome accession   NZ_CP017952
Coordinates   1384171..1385172 (-) Length   333 a.a.
NCBI ID   WP_003101380.1    Uniprot ID   -
Organism   Streptococcus iniae strain 89353     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1369296..1440462 1384171..1385172 within 0


Gene organization within MGE regions


Location: 1369296..1440462
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BMF34_RS06775 (BMF34_06705) dhaS 1370365..1370910 (+) 546 WP_003101362.1 dihydroxyacetone kinase transcriptional activator DhaS -
  BMF34_RS06780 (BMF34_06710) dhaQ 1370913..1371902 (+) 990 WP_003101364.1 DhaKLM operon coactivator DhaQ -
  BMF34_RS06790 (BMF34_06720) - 1372495..1373606 (+) 1112 WP_089180045.1 IS3-like element IS981 family transposase -
  BMF34_RS06795 (BMF34_06725) - 1373815..1374990 (-) 1176 WP_003099060.1 IS256 family transposase -
  BMF34_RS06800 (BMF34_06730) - 1375057..1375458 (-) 402 WP_016356083.1 ATP-binding cassette domain-containing protein -
  BMF34_RS06805 (BMF34_06735) - 1375848..1376633 (-) 786 WP_003101367.1 ABC transporter permease -
  BMF34_RS06810 (BMF34_06740) - 1376635..1377453 (-) 819 WP_003101368.1 ABC-2 family transporter protein -
  BMF34_RS06815 (BMF34_06745) - 1377455..1378447 (-) 993 WP_003101369.1 ATP-binding cassette domain-containing protein -
  BMF34_RS06820 (BMF34_06750) tnpA 1378723..1379187 (-) 465 WP_003101370.1 IS200/IS605 family transposase -
  BMF34_RS06825 (BMF34_06755) thrS 1379380..1381320 (-) 1941 WP_003101371.1 threonine--tRNA ligase -
  BMF34_RS06830 (BMF34_06760) - 1381705..1383042 (-) 1338 WP_003101376.1 glycosyltransferase family 4 protein -
  BMF34_RS06835 (BMF34_06765) - 1383044..1384042 (-) 999 WP_003101378.1 glycosyltransferase family 4 protein -
  BMF34_RS06840 (BMF34_06770) ccpA 1384171..1385172 (-) 1002 WP_003101380.1 catabolite control protein A Regulator
  BMF34_RS06845 (BMF34_06775) - 1385344..1386429 (+) 1086 WP_003101382.1 Xaa-Pro peptidase family protein -
  BMF34_RS06850 (BMF34_06780) - 1386592..1386933 (-) 342 WP_003101385.1 hypothetical protein -
  BMF34_RS06855 (BMF34_06785) - 1387123..1387785 (+) 663 WP_003101387.1 NAD(P)H-dependent oxidoreductase -
  BMF34_RS06860 (BMF34_06790) - 1387796..1388176 (+) 381 WP_003101389.1 VOC family protein -
  BMF34_RS06865 (BMF34_06795) - 1388303..1389229 (+) 927 WP_003101392.1 glycosyltransferase family 2 protein -
  BMF34_RS06870 (BMF34_06800) - 1389373..1390056 (+) 684 WP_016356084.1 DUF969 domain-containing protein -
  BMF34_RS06875 (BMF34_06805) - 1390056..1390982 (+) 927 WP_003101395.1 DUF979 domain-containing protein -
  BMF34_RS06880 (BMF34_06810) - 1391064..1392239 (-) 1176 WP_003099060.1 IS256 family transposase -
  BMF34_RS06885 (BMF34_06815) pcp 1392366..1393013 (+) 648 WP_003101396.1 pyroglutamyl-peptidase I -
  BMF34_RS06890 (BMF34_06820) - 1393164..1393880 (-) 717 WP_003101397.1 glutaminyl-peptide cyclotransferase -
  BMF34_RS06895 (BMF34_06825) smpB 1393890..1394357 (-) 468 WP_003101398.1 SsrA-binding protein SmpB -
  BMF34_RS06900 (BMF34_06830) rnr 1394357..1396672 (-) 2316 WP_003101399.1 ribonuclease R -
  BMF34_RS06905 (BMF34_06835) secG 1396759..1396995 (-) 237 WP_003101400.1 preprotein translocase subunit SecG -
  BMF34_RS06910 rpmG 1397041..1397187 (-) 147 WP_016356085.1 50S ribosomal protein L33 -
  BMF34_RS06915 (BMF34_06840) - 1397429..1398910 (-) 1482 WP_003101401.1 helicase HerA-like domain-containing protein -
  BMF34_RS06920 (BMF34_06845) - 1399010..1399648 (-) 639 WP_003101409.1 YitT family protein -
  BMF34_RS06925 (BMF34_06850) coaE 1399656..1400258 (-) 603 WP_016356086.1 dephospho-CoA kinase -
  BMF34_RS06930 (BMF34_06855) mutM 1400225..1401064 (-) 840 WP_003101415.1 DNA-formamidopyrimidine glycosylase -
  BMF34_RS06935 (BMF34_06860) - 1401257..1402096 (-) 840 WP_003101416.1 helix-turn-helix domain-containing protein -
  BMF34_RS10675 - 1402186..1402254 (+) 69 WP_142924915.1 SHP2/SHP3 family peptide pheromone -
  BMF34_RS06940 (BMF34_06865) - 1402373..1403995 (+) 1623 WP_003101417.1 transglutaminase domain-containing protein -
  BMF34_RS10550 - 1404135..1404284 (+) 150 WP_016356087.1 hypothetical protein -
  BMF34_RS06950 (BMF34_06875) - 1404816..1405055 (-) 240 Protein_1287 ABC transporter ATP-binding protein -
  BMF34_RS06955 (BMF34_06880) - 1405138..1406313 (+) 1176 WP_003099060.1 IS256 family transposase -
  BMF34_RS06960 (BMF34_06885) - 1406348..1406773 (-) 426 WP_016356089.1 ATP-binding cassette domain-containing protein -
  BMF34_RS06970 (BMF34_06895) - 1407376..1408167 (-) 792 WP_003101421.1 hypothetical protein -
  BMF34_RS06975 (BMF34_06900) - 1408221..1408610 (-) 390 WP_003101424.1 hypothetical protein -
  BMF34_RS06980 (BMF34_06905) - 1408811..1409287 (-) 477 WP_003101426.1 NUDIX hydrolase -
  BMF34_RS06985 (BMF34_06910) era 1409359..1410258 (-) 900 WP_003101428.1 GTPase Era -
  BMF34_RS06990 (BMF34_06915) - 1410386..1410793 (-) 408 WP_003101429.1 diacylglycerol kinase family protein -
  BMF34_RS06995 (BMF34_06920) ybeY 1410774..1411271 (-) 498 WP_003101433.1 rRNA maturation RNase YbeY -
  BMF34_RS07000 (BMF34_06925) - 1411364..1411936 (-) 573 WP_003101435.1 uracil-DNA glycosylase family protein -
  BMF34_RS07005 (BMF34_06930) - 1411978..1413042 (-) 1065 WP_003101437.1 PhoH family protein -
  BMF34_RS07010 (BMF34_06935) - 1413261..1414598 (+) 1338 WP_003101438.1 MFS transporter -
  BMF34_RS07015 (BMF34_06940) - 1414649..1416421 (-) 1773 WP_016356091.1 oleate hydratase -
  BMF34_RS07020 (BMF34_06945) - 1416592..1416807 (-) 216 WP_017794750.1 YozE family protein -
  BMF34_RS07025 (BMF34_06950) msrA 1416818..1417342 (-) 525 WP_031239310.1 peptide-methionine (S)-S-oxide reductase MsrA -
  BMF34_RS07030 (BMF34_06955) - 1417420..1418274 (-) 855 WP_003101451.1 S1 RNA-binding domain-containing protein -
  BMF34_RS07035 (BMF34_06960) frr 1418384..1418941 (-) 558 WP_003101453.1 ribosome recycling factor -
  BMF34_RS07040 (BMF34_06965) pyrH 1418967..1419701 (-) 735 WP_003101454.1 UMP kinase -
  BMF34_RS07045 (BMF34_06970) rplA 1419850..1420539 (-) 690 WP_003101458.1 50S ribosomal protein L1 -
  BMF34_RS07050 (BMF34_06975) rplK 1420644..1421069 (-) 426 WP_003101459.1 50S ribosomal protein L11 -
  BMF34_RS07055 (BMF34_06980) - 1421326..1422492 (+) 1167 WP_003099776.1 IS30 family transposase -
  BMF34_RS07060 (BMF34_06985) - 1422825..1423175 (+) 351 WP_003101461.1 DUF3397 family protein -
  BMF34_RS07065 (BMF34_06990) - 1423205..1425610 (-) 2406 WP_016356093.1 DNA translocase FtsK -
  BMF34_RS07070 (BMF34_06995) - 1425824..1426627 (+) 804 WP_003101471.1 peptidylprolyl isomerase -
  BMF34_RS07075 (BMF34_07000) - 1426680..1427531 (-) 852 WP_003101472.1 metal ABC transporter permease -
  BMF34_RS07080 (BMF34_07005) - 1427525..1428253 (-) 729 WP_003101473.1 metal ABC transporter ATP-binding protein -
  BMF34_RS07085 (BMF34_07010) - 1428319..1429248 (-) 930 WP_003101474.1 metal ABC transporter substrate-binding protein -
  BMF34_RS07090 (BMF34_07015) - 1429393..1430040 (+) 648 WP_003101475.1 metal-dependent transcriptional regulator -
  BMF34_RS07095 (BMF34_07020) - 1430175..1430867 (-) 693 WP_003101476.1 5'-methylthioadenosine/adenosylhomocysteine nucleosidase -
  BMF34_RS07100 (BMF34_07025) macP 1430879..1431139 (-) 261 WP_003101477.1 cell wall synthase accessory phosphoprotein MacP -
  BMF34_RS07105 (BMF34_07030) - 1431142..1431693 (-) 552 WP_003101478.1 NUDIX hydrolase -
  BMF34_RS07110 (BMF34_07035) glmU 1431712..1433097 (-) 1386 WP_003101479.1 bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU -
  BMF34_RS07115 (BMF34_07040) - 1433198..1434163 (-) 966 WP_003101480.1 Gfo/Idh/MocA family protein -
  BMF34_RS07120 (BMF34_07045) - 1434190..1434888 (-) 699 WP_003101481.1 3-oxoacyl-ACP reductase -
  BMF34_RS07125 (BMF34_07050) - 1434881..1435117 (-) 237 WP_003101483.1 DUF2829 domain-containing protein -
  BMF34_RS07130 (BMF34_07055) - 1435201..1435488 (-) 288 Protein_1322 tyrosine-type recombinase/integrase -
  BMF34_RS10680 - 1435754..1436188 (+) 435 WP_225111322.1 isochorismatase family protein -
  BMF34_RS07140 (BMF34_07065) - 1436314..1436640 (-) 327 WP_003101486.1 hypothetical protein -
  BMF34_RS07145 (BMF34_07070) - 1436828..1437742 (-) 915 WP_003101487.1 magnesium transporter CorA family protein -
  BMF34_RS07150 (BMF34_07075) brnQ 1437824..1439167 (-) 1344 WP_037583405.1 branched-chain amino acid transport system II carrier protein -

Sequence

Protein


Download         Length: 333 a.a.        Molecular weight: 36613.69 Da        Isoelectric Point: 5.7671

>NTDB_id=204340 BMF34_RS06840 WP_003101380.1 1384171..1385172(-) (ccpA) [Streptococcus iniae strain 89353]
MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDYRPNAVARGLASKKTTTVGVVIPNIANAYFS
ILAKGIDDIAAMYKYNIVLASSDEDDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPIVLAGTVDLEHQLPS
VNIDYKAAVSEIVDILAENHQKIAFVSGPLIDDINGKVRLSGYKEGLKKNKLSYKEGLVFEAKYSYRDGFDLAQRVINSG
ATAAYVGEDELAAGLLNGLFAAGKSVPEDFEIFTSNDSPVVEYTSPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEI
LLNHGIKRRGTTK

Nucleotide


Download         Length: 1002 bp        

>NTDB_id=204340 BMF34_RS06840 WP_003101380.1 1384171..1385172(-) (ccpA) [Streptococcus iniae strain 89353]
ATGAACACAGATGATACAATTACGATATATGATGTTGCTCGTGAAGCAGGTGTTTCAATGGCAACAGTCAGCCGTGTTGT
AAATGGTAATAAAAACGTTAAGGAAAATACCCGTAAGAAAGTTTTAGAAGTTATCGACCGTTTAGACTACCGCCCAAATG
CTGTAGCTAGAGGTCTAGCAAGTAAAAAAACAACAACAGTTGGTGTGGTTATTCCTAACATTGCTAATGCTTATTTTTCA
ATTTTGGCTAAAGGAATTGATGATATTGCAGCAATGTACAAATATAATATTGTTCTGGCATCTAGTGATGAGGATGATGA
TAAGGAAGTTAACGTTGTTAACACTTTGTTTGCAAAACAAGTTGATGGCATCATTTTTATGGGGCATCATTTAACAGAAA
AAATCCGTGCAGAGTTTTCTCGTTCACGGACACCTATTGTTCTTGCTGGAACAGTTGATTTAGAACATCAATTACCAAGT
GTTAATATTGATTACAAGGCGGCAGTTTCTGAAATTGTTGATATTTTGGCTGAAAACCATCAAAAAATTGCTTTTGTTTC
AGGACCGCTTATTGATGATATTAATGGAAAAGTAAGACTTTCAGGTTATAAAGAAGGCCTTAAAAAGAATAAATTAAGTT
ACAAAGAAGGCCTTGTTTTTGAAGCGAAATACTCATACAGAGACGGTTTTGACTTGGCACAACGTGTGATTAATTCAGGA
GCAACTGCTGCCTATGTTGGAGAAGATGAATTAGCAGCAGGTTTGTTAAATGGTCTTTTTGCAGCAGGTAAAAGTGTTCC
AGAAGATTTTGAGATTTTCACAAGTAATGATTCACCTGTTGTTGAATACACAAGCCCTAACTTAAGCTCAATCAGCCAAC
CAGTTTATGACTTAGGTGCTGTAAGTATGCGTATGTTAACAAAAATCATGAACAAAGAAGAACTTGAAGAAAAAGAAATC
CTGTTAAATCATGGCATTAAACGCCGTGGCACAACAAAATAA

Domains

Predicted by InterproScan.

Periplasmic binding protein-like domain (Peripla_BP_3)

(177-332)

Bacterial regulatory proteins, lacI family (LacI)

(8-53)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ccpA Streptococcus gordonii str. Challis substr. CH1

78.979

100

0.79
  ccpA Streptococcus pneumoniae D39

77.177

100

0.772
  ccpA Lactococcus lactis subsp. lactis strain DGCC12653

54.381

99.399

0.541

Multiple sequence alignment